KEGG   Escherichia coli K-12 MG1655: b0808
Entry
b0808             CDS       T00007                                 

Symbol
ybiO
Name
(RefSeq) moderate conductance mechanosensitive channel
  KO
K22044  moderate conductance mechanosensitive channel
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0808 (ybiO)
Transporters [BR:eco02000]
 Other transporters
  Pores ion channels [TC:1]
   b0808 (ybiO)
SSDB
Motif
Pfam: MS_channel
Other DBs
NCBI-GeneID: 945935
NCBI-ProteinID: NP_415329
Pasteur: ybiO
RegulonDB: ECK120003017
ECOCYC: G6417
ASAP: ABE-0002760
UniProt: P75783
Position
complement(843255..845480)
AA seq 741 aa
MRWILFILFCLLGAPAHAVSIPGVTTTTTTDSTTEPAPEPDIEQKKAAYGALADVLDNDT
SRKELIDQLRTVAATPPAEPVPKIVPPTLVEEQTVLQKVTEVSRHYGEALSARFGQLYRN
ITGSPHKPFNPQTFSNALTHFSMLAVLVFGFYWLIRLCALPLYRKMGQWARQKNRERSNW
LQLPAMIIGAFIIDLLLLALTLFVGQVLSDNLNAGSRTIAFQQSLFLNAFALIEFFKAVL
RLIFCPNVAELRPFTIQDESARYWSRRLSWLSSLIGYGLIVAVPIISNQVNVQIGALANV
IIMLCMTVWALYLIFRNKKEITQHLLNFAEHSLAFFSLFIRAFALVWHWLASAYFIVLFF
FSLFDPGNSLKFMMGATVRSLAIIGIAAFVSGMFSRWLAKTITLSPHTQRNYPELQKRLN
GWLSAALKTARILTVCVAVMLLLSAWGLFDFWNWLQNGAGQKTVDILIRIALILFFSAVG
WTVLASLIENRLASDIHGRPLPSARTRTLLTLFRNALAVIISTITIMIVLSEIGVNIAPL
LAGAGALGLAISFGSQTLVKDIITGVFIQFENGMNTGDLVTIGPLTGTVERMSIRSVGVR
QDTGAYHIIPWSSITTFANFVRGIGSVVANYDVDRHEDADKANQALKDAVAELMENEEIR
GLIIGEPNFAGIVGLSNTAFTLRVSFTTLPLKQWTVRFALDSQVKKHFDLAGVRAPVQTY
QVLPAPGATPAEPLPPGEPTL
NT seq 2226 nt   +upstreamnt  +downstreamnt
atgcggtggatcctgttcatcctcttctgcctgctgggcgcacctgcccacgcggtatcc
atacccggcgttacaaccacaacgacaacggactcaacgactgaaccggccccggaaccg
gatatcgaacaaaaaaaagcggcctatggcgcactggcggatgtgctggataatgacacc
tcgcgtaaagagttgatcgaccagttgcgcaccgttgccgctacgccccctgctgaaccg
gtaccaaaaatagtgccgccgacgctggtcgaagagcaaaccgtgctgcaaaaggtcacc
gaagtcagccgccattatggtgaagccctttccgcccgcttcgggcaactttatcgcaat
atcaccggctccccgcataagccgtttaatccacaaaccttcagcaatgcgctgacccat
ttttcaatgttagcggtattagtgtttggtttttactggctgattcgcctgtgcgcactg
ccgctgtatcgcaaaatgggtcagtgggcgcggcaaaaaaatcgtgagcgcagcaactgg
ttgcagcttccggcgatgattatcggggcgtttattatcgacctgctgttactggccctg
acattatttgtcggccaggtattaagcgacaacctgaatgcaggcagtcgcaccatcgct
ttccaacaaagtttgtttctcaacgcctttgccctcattgaatttttcaaagccgtacta
cgcctgattttttgcccaaacgtggcggagctgcgcccgttcacgattcaggacgagagc
gcccgttactggagtcgtcgcctgagctggttaagcagtttgataggttatggcctgatt
gtggccgtgccgattatctctaatcaggtgaatgtacagataggtgcgctggcgaacgtc
atcattatgctgtgcatgaccgtctgggcgttgtacctgatctttcgtaataaaaaagag
attacccagcatttgctcaacttcgcggagcattcgctggcctttttcagcctgtttatc
cgcgcctttgcgctggtgtggcactggctggcaagcgcctattttatcgtgctgtttttc
ttttcgttgttcgatccgggcaacagcctgaaatttatgatgggtgcaacggtgcgcagc
ctggcgattattggtatcgcagcgtttgtttccggtatgttttcccgctggctggcgaaa
accatcactctctcgccacatactcagcgtaactatccggagctgcaaaaacggttgaat
ggctggctgtcggcggcgctgaaaacggcgcgtattctgacagtctgcgtggcggtaatg
ttgctgttgagcgcatggggattgttcgatttctggaactggctgcaaaacggcgcgggg
cagaaaaccgtagatatcctgatccgtatcgcactcattcttttcttctcggcggttggc
tggacggtgctcgccagtttgatcgaaaaccggctggcttcggatattcatggccgcccg
ctacccagcgcccgcacgcgtaccctgcttacgctgtttcgtaacgcgctggcggtgatt
atcagtaccatcaccatcatgattgtgttgtcggaaatcggcgtcaatatcgcgccattg
ctggcaggtgccggggcattaggtctggctatctcgtttggttcgcaaacgctggtgaaa
gatattatcaccggggtatttattcagtttgaaaacggcatgaacactggagatttggtg
actatcgggccgttgaccggcacagtggaacggatgtcgattcgctccgtgggcgtacga
caggataccggggcgtatcacatcattccgtggtcttcgataaccacctttgctaacttt
gtccgcggcattggttcggtggtggcaaattatgatgttgatcgccatgaagatgctgat
aaagccaatcaggcactgaaagatgcggtagcggaattaatggaaaacgaagaaattcgc
gggctgattattggtgaaccgaattttgccgggattgtcggcttaagcaataccgcgttt
acactgcgtgtttcgttcaccacgctgccactcaaacagtggacggtacgctttgccctc
gacagccaggtgaaaaaacatttcgacctggcgggcgttcgcgcgccagtgcagacttat
caggtgctgcctgctccgggcgcgaccccggctgaaccgttaccgccgggggaaccaacg
ctttaa

DBGET integrated database retrieval system