KEGG   Escherichia coli K-12 MG1655: b0810Help
Entry
b0810             CDS       T00007                                 

Gene name
glnP
Definition
(RefSeq) L-glutamine ABC transporter membrane subunit
  KO
K10037  glutamine transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b0810 (glnP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0810 (glnP)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamine transporter
    b0810 (glnP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 945621
NCBI-ProteinID: NP_415331
Pasteur: glnP
RegulonDB: ECK120000381
ECOCYC: EG10388
ASAP: ABE-0002766
UniProt: P0AEQ6
Position
complement(846460..847119)
Genome map
AA seq 219 aa AA seqDB search
MQFDWSAIWPAIPLLIEGAKMTLWISVLGLAGGLVIGLLAGFARTFGGWIANHVALVFIE
VIRGTPIVVQVMFIYFALPMAFNDLRIDPFTAAVVTIMINSGAYIAEITRGAVLSIHKGF
REAGLALGLSRWETIRYVILPLALRRMLPPLGNQWIISIKDTSLFIVIGVAELTRQGQEI
IAGNFRALEIWSAVAVFYLIITLVLSFILRRLERRMKIL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttgactggagtgccatctggcctgccattccgcttctgattgaaggtgccaaa
atgaccctgtggatttcggtcctcggtctggcaggcggtctggtaatcggattgctggca
ggttttgcacgcaccttcggaggttggatagccaaccacgtcgcgctggtctttattgaa
gtgatccgcggcacacctatcgtcgtccaggtgatgtttatttatttcgccctgccgatg
gcgtttaacgacttacgcatcgacccatttactgcggcggtggtcaccatcatgatcaac
tccggcgcgtatattgcggaaatcacgcgtggtgcggtgctgtctatccacaaaggtttt
cgtgaagcaggactggcgctcggtctttcacgttgggaaaccattcgctacgtcatttta
ccgctggcactgcgtcgtatgctgccgccgctgggtaaccagtggatcatcagcattaaa
gacacctcgctgtttattgtgatcggcgtggcggaactgacccgtcaggggcaagaaatt
attgccggtaacttccgcgcccttgagatctggagcgccgtggcggtgttctatctgatt
attaccctggtgctgagctttattctgcgtcgtctggaaagaaggatgaaaatcctgtga

DBGET integrated database retrieval system