KEGG   Escherichia coli K-12 MG1655: b0811
Entry
b0811             CDS       T00007                                 

Symbol
glnH
Name
(RefSeq) L-glutamine ABC transporter periplasmic binding protein
  KO
K10036  glutamine transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b0811 (glnH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0811 (glnH)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamine transporter
    b0811 (glnH)
SSDB
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd
Other DBs
NCBI-GeneID: 944872
NCBI-ProteinID: NP_415332
Pasteur: glnH
RegulonDB: ECK120000379
ECOCYC: EG10386
ASAP: ABE-0002771
UniProt: P0AEQ3
Structure
Position
complement(847258..848004)
AA seq 248 aa
MKSVLKVSLAALTLAFAVSSHAADKKLVVATDTAFVPFEFKQGDKYVGFDVDLWAAIAKE
LKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANN
NDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDT
PNILYFIKTAGNGQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYK
KWFGTEPK
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaagtctgtattaaaagtttcactggctgcactgaccctggcttttgcggtttcttct
catgccgcggataaaaaattagttgtcgcgacggataccgccttcgttccgtttgaattt
aaacagggcgataaatatgtgggctttgacgttgatctgtgggctgccatcgctaaagag
ctgaagctggattacgaactgaagccgatggatttcagtgggatcattccggcactgcaa
accaaaaacgtcgatctggcgctggcgggcattaccatcaccgacgagcgtaaaaaagcg
atcgatttctctgacggctactacaaaagcggcctgttagtgatggtgaaagctaacaat
aacgatgtgaaaagcgtgaaagatctcgacgggaaagtggttgctgtgaagagcggtact
ggctccgttgattacgcgaaagcaaacatcaaaactaaagatctgcgtcagttcccgaac
atcgataacgcctatatggaactgggcaccaaccgcgcagacgccgttctgcacgatacg
ccaaacattctgtacttcatcaaaaccgccggtaacggtcagttcaaagcggtaggtgac
tctctggaagcgcagcaatacggtattgcgttcccgaaaggtagcgacgagctgcgtgac
aaagtcaacggcgcgttgaaaaccctgcgcgagaacggaacttacaacgaaatctacaaa
aaatggttcggtactgaaccgaaataa

DBGET integrated database retrieval system