KEGG   Escherichia coli K-12 MG1655: b0813
Entry
b0813             CDS       T00007                                 
Symbol
rhtA
Name
(RefSeq) L-threonine/L-homoserine exporter
  KO
K11939  inner membrane transporter RhtA
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0813 (rhtA)
Transporters [BR:eco02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   b0813 (rhtA)
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-GeneID: 947045
NCBI-ProteinID: NP_415334
Pasteur: ybiF
RegulonDB: ECK120002036
ECOCYC: EG12134
ASAP: ABE-0002779
UniProt: P0AA67
Position
complement(849210..850097)
AA seq 295 aa
MPGSLRKMPVWLPIVILLVAMASIQGGASLAKSLFPLVGAPGVTALRLALGTLILIAFFK
PWRLRFAKEQRLPLLFYGVSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV
DFVWVVLAVLGLWFLLPLGQDVSHVDLTGCALALGAGACWAIYILSGQRAGAEHGPATVA
IGSLIAALIFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGT
LMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN
NT seq 888 nt   +upstreamnt  +downstreamnt
atgcctggttcattacgtaaaatgccggtctggttaccaatagtcatattgctcgttgcc
atggcgtctattcagggtggagcctcgttagctaagtcactttttcctctggtgggcgca
ccgggtgtcactgcgctgcgtctggcattaggaacgctgatcctcatcgcgttctttaag
ccatggcgactgcgctttgccaaagagcaacggttaccgctgttgttttacggcgtttcg
ctgggtgggatgaattatcttttttatctttctattcagacagtaccgctgggtattgcg
gtggcgctggagttcaccggaccactggcggtggcgctgttctcttctcgtcgcccggta
gatttcgtctgggttgtgctggcggttcttggtctgtggttcctgctaccgctggggcaa
gacgtttcccatgtcgatttaaccggctgtgcgctggcactgggggccggggcttgttgg
gctatttacattttaagtgggcaacgcgcaggagcggaacatggccctgcgacggtggca
attggttcgttgattgcagcgttaattttcgtgccaattggagcgcttcaggctggtgaa
gcactctggcactggtcggttattccattgggtctggctgtcgctattctctcgaccgct
ctgccttattcgctggaaatgattgccctcacccgtttgccaacacggacatttggtacg
ctgatgagcatggaaccggcgctggctgccgtttccgggatgattttcctcggagaaaca
ctgacacccatacagctactggcgctcggcgctatcatcgccgcttcaatggggtctacg
ctgacagtacgcaaagagagcaaaataaaagaattagacattaattaa

DBGET integrated database retrieval system