KEGG   Escherichia coli K-12 MG1655: b0845
Entry
b0845             CDS       T00007                                 

Symbol
ybjJ
Name
(RefSeq) inner membrane protein YbjJ
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 945471
NCBI-ProteinID: NP_415366
Pasteur: ybjJ
RegulonDB: ECK120003043
ECOCYC: G6443
ASAP: ABE-0002880
UniProt: P75810
Position
complement(886131..887339)
AA seq 402 aa
MTVNSSRNALKRRTWALFMFFFLPGLLMASWATRTPAIRDILSVSIAEMGGVLFGLSIGS
MSGILCSAWLVKRFGTRNVILVTMSCALIGMMILSLALWLTSPLLFAVGLGVFGASFGSA
EVAINVEGAAVEREMNKTVLPMMHGFYSLGTLAGAGVGMALTAFGVPATVHILLAALVGI
APIYIAIQAIPDGTGKNAADGTQHGEKGVPFYRDIQLLLIGVVVLAMAFAEGSANDWLPL
LMVDGHGFSPTSGSLIYAGFTLGMTVGRFTGGWFIDRYSRVAVVRASALMGALGIGLIIF
VDSAWVAGVSVVLWGLGASLGFPLTISAASDTGPDAPTRVSVVATTGYLAFLVGPPLLGY
LGEHYGLRSAMLVVLALVILAAIVAKAVAKPDTKTQTAMENS
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgaccgtaaattcttcacgtaatgcattgaaacgccgaacctgggcgctgtttatgttc
ttctttttgccaggcctgttaatggcgtcctgggcaacccgtacgcctgctatccgcgat
attctctctgtctcgatcgctgaaatgggcggtgttctctttggtctgtcgatcggttcg
atgagcggtattctctgctcggcgtggttagtgaaacgctttgggacacgtaatgtcatc
ctggtcacgatgtcctgcgcattgatcgggatgatgatattaagtctggcactctggctg
acatcgcccctgctctttgccgttggtctcggcgtctttggggcaagttttggttctgcg
gaagtggcgataaacgttgaaggtgctgccgttgagcgagaaatgaataagacggttttg
ccgatgatgcacggtttttatagcctgggcacgctggcaggcgcaggtgtcgggatggca
ctgacggcctttggcgttccggcaacggtgcacattttattggcggcgctggtaggtatc
gcacctatttatatcgccattcaggcaatccctgacggtacgggcaaaaatgctgccgat
ggcacccagcatggcgaaaaaggcgtacctttttatcgcgatatccagttgctgctgata
ggtgttgtggtgctggcgatggcctttgccgaaggttctgccaacgactggttaccctta
ttaatggttgacggtcacggttttagccctacttccggctcgctgatttatgccggtttt
accctggggatgaccgttggacgcttcaccggcggttggttcatcgaccgttacagtcgc
gttgccgtggttcgggccagtgcactaatgggggcgttgggtattgggctgattattttt
gtcgatagcgcctgggtcgctggggtgtctgttgtactctggggactgggtgcctcgctg
ggcttcccgctgaccatttctgccgccagcgataccggccccgatgcaccaacccgcgtc
agtgtggtagcaacgaccggttatctggctttcctcgtcgggccgccgctgctgggctat
ctcggcgaacattatggattacgtagtgcaatgctggttgtactggcgctggttattctc
gcggctattgtcgcgaaagccgtcgccaaacccgataccaaaacgcagacggcgatggag
aatagttga

DBGET integrated database retrieval system