KEGG   Escherichia coli K-12 MG1655: b0852Help
Entry
b0852             CDS       T00007                                 

Gene name
rimK
Definition
(RefSeq) ribosomal protein S6 modification protein
  KO
K05844  ribosomal protein S6--L-glutamate ligase [EC:6.3.2.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:eco03009]
    b0852 (rimK)
Enzymes [BR:eco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     b0852 (rimK)
Ribosome biogenesis [BR:eco03009]
 Prokaryotic Type
  ribosomal protein modification factors
   b0852 (rimK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK Rimk_N GSH-S_ATP ATP-grasp_3 ATPgrasp_ST Dala_Dala_lig_C ATPgrasp_YheCD Arm-DNA-bind_3 GARS_A R2K_3
Motif
Other DBs
NCBI-GeneID: 945484
NCBI-ProteinID: NP_415373
Pasteur: rimK
RegulonDB: ECK120000843
ECOCYC: EG10852
ASAP: ABE-0002903
UniProt: P0C0U4 A0A387CZV7
Structure
PDB: 

Position
891967..892869
Genome map
AA seq 300 aa AA seqDB search
MKIAILSRDGTLYSCKRLREAAIQRGHLVEILDPLSCYMNINPAASSIHYKGRKLPHFDA
VIPRIGTAITFYGTAALRQFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVTGIA
HSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVIDAFRGLNAHILVQEYI
KEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASVASITPQEREIAIKAARTM
ALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIAGKMIRWIERHATTEYCLKTGG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattgccatattgtcccgggatggaacgctctattcgtgtaagcggctgcgtgaa
gccgctatacagcgcggtcacctggttgaaattcttgatccgctttcttgctacatgaac
ataaatcctgcggcgtcttctattcactacaaaggccgcaagttaccccattttgacgca
gtgatcccgcgtattggcaccgccattaccttttatgggacggcggcactgcgccagttc
gagatgctggggagctatccgctcaatgagtcggtcgccattgcccgggcgcgtgacaaa
ttgcgttccatgcaactgctggcgcgtcagggcatcgacctgcctgtcacgggcattgcg
cattcgccggatgataccagcgatttaatcgacatggtcggtggtgcgccgctggtggtc
aagttggttgaaggcacgcagggaattggcgtcgtgctggcggagacgcgtcaggcggcg
gaaagcgtgattgacgctttccgcggtctgaacgcgcatattctggtgcaggaatatatc
aaagaggcgcaagggtgcgatatccgctgtctggttgttggcgatgaagtggtcgctgcg
attgaacggcgggcgaaagagggcgattttcgttccaatttgcatcgtggcggcgcggca
agcgtcgccagtatcacaccacaggagcgtgaaatcgcgataaaagccgcgcgaacgatg
gcgctggacgttgctggtgtggatattctgcgtgctaatcgcgggccgttggtgatggag
gtgaatgcgtcgccggggctggaaggaatagaaaaaaccaccggtatcgacatcgcgggt
aaaatgatccgctggatcgaacgccacgctacgacagaatattgcctgaaaacgggtggt
tag

DBGET integrated database retrieval system