KEGG   Escherichia coli K-12 MG1655: b0857Help
Entry
b0857             CDS       T00007                                 

Gene name
potI
Definition
(RefSeq) putrescine ABC transporter permease
  KO
K11074  putrescine transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00300  Putrescine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0857 (potI)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter [MD:M00300] [OT]
    b0857 (potI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF3938
Motif
Other DBs
NCBI-GeneID: 945485
NCBI-ProteinID: NP_415378
Pasteur: potI
RegulonDB: ECK120001580
ECOCYC: EG11632
ASAP: ABE-0002919
UniProt: P0AFL1
Position
897084..897929
Genome map
AA seq 281 aa AA seqDB search
MNNLPVVRSPWRIVILLLGFTFLYAPMLMLVIYSFNSSKLVTVWAGWSTRWYGELLRDDA
MMSAVGLSLTIAACAATAAAILGTIAAVVLVRFGRFRGSNGFAFMITAPLVMPDVITGLS
LLLLFVALAHAIGWPADRGMLTIWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGAT
PLKVFFVITLPMIMPAIISGWLLAFTLSLDDLVIASFVSGPGATTLPMLVFSSVRMGVNP
EINALATLILGAVGIVGFIAWYLMARAEKQRIRDIQRARRG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttaccggtagttcgttcgccctggcggattgtgattttgctgctgggcttt
acctttctctacgcgccaatgctgatgctggttatctattcgtttaacagctcgaagctg
gtgacggtgtgggccggctggtcaacgcgctggtatggtgagttattgcgcgatgacgcg
atgatgagtgcggttggtttaagtctgacaattgcggcctgtgcggcgacggcggcggcg
atcctcggaactattgcggcggtggtgctggtgcgctttggcaggtttcgcggatcaaat
ggctttgcctttatgatcaccgcgccgctggtaatgccagatgtcatcacgggcttgtcg
ctgttgttattattcgtcgcgcttgctcatgccattggctggcctgcggaccgcggtatg
ctcaccatctggctggcgcatgtcactttttgtacggcttatgtggcggtcgttatttct
tcaagattgcgggaactggatcgctcgatagaagaagcagcgatggatctcggtgcgacg
ccgctgaaagtgtttttcgtcattacgctaccgatgatcatgcccgcgatcatttctggc
tggttactggcttttactttgtcgcttgatgatctggtgatcgccagctttgtttccggg
ccgggagccaccacgttaccgatgctggtcttttccagcgtgcggatgggggtgaatccg
gaaatcaacgccctggcaacattgatcctcggcgcggtcggaattgtcggatttatcgcc
tggtatctgatggctcgcgcagaaaaacagcggatacgcgacatccagcgtgcaagacgt
ggctga

DBGET integrated database retrieval system