KEGG   Escherichia coli K-12 MG1655: b0858
Entry
b0858             CDS       T00007                                 

Gene name
ybjO
Definition
(RefSeq) putative inner membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: DUF2593
Other DBs
NCBI-GeneID: 945488
NCBI-ProteinID: NP_415379
Pasteur: ybjO
RegulonDB: ECK120003048
ECOCYC: G6448
ASAP: ABE-0002922
UniProt: P0AAZ0
Position
897989..898477
AA seq 162 aa
MEDETLGFFKKTSSSHARLNVPALVQVAALAIIMIRGLDVLMIFNTLGVRGIGEFIHRSV
QTWSLTLVFLSSLVLVFIEIWCAFSLVKGRRWARWLYLLTQITAASYLWAASLGYGYPEL
FSIPGESKREIFHSLMLQKLPDMLILMLLFVPSTSRRFFQLQ
NT seq 489 nt   +upstreamnt  +downstreamnt
atggaagacgaaacgttgggattttttaagaaaacatcttcatctcatgctcgcctgaat
gtgcctgcgctggtgcaggtggcggcgctcgccattattatgatccgtggcctcgacgtg
ctgatgattttcaatacgctgggcgtgcgcggtattggcgagttcattcatcgcagcgta
caaacctggagtttaacgctggtctttttaagcagtctggtgctggttttcattgagatc
tggtgtgcgttttcactggtgaaagggcgtcgctgggcgcgctggctatatctgctgaca
caaatcaccgccgcaagttacttgtgggcggcttcgctggggtacggttatccggagctg
ttcagcattcccggtgaatcaaaacgtgaaatcttccatagcctgatgctgcagaagctg
ccggatatgctcatcctgatgctgctgttcgttccctcgaccagtcggcggttcttccag
ttgcaataa

DBGET integrated database retrieval system