KEGG   Escherichia coli K-12 MG1655: b0860Help
Entry
b0860             CDS       T00007                                 

Gene name
artJ
Definition
(RefSeq) arginine ABC transporter periplasmic binding protein
  KO
K09996  arginine transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00229  Arginine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0860 (artJ)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Arginine transporter [MD:M00229] [OT]
    b0860 (artJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd NMT1_3 YhfZ_C
Motif
Other DBs
NCBI-GeneID: 948981
NCBI-ProteinID: NP_415381
Pasteur: artJ
RegulonDB: ECK120001576
ECOCYC: EG11628
ASAP: ABE-0002927
UniProt: P30860
Position
complement(899844..900575)
Genome map
AA seq 243 aa AA seqDB search
MKKLVLAALLASFTFGASAAEKINFGVSATYPPFESIGANNEIVGFDIDLAKALCKQMQA
ECTFTNHAFDSLIPSLKFRKYDAVISGMDITPERSKQVSFTTPYYENSAVVIAKKDTYKT
FADLKGKRIGMENGTTHQKYIQDQHPEVKTVSYDSYQNAFIDLKNGRIDGVFGDTAVVNE
WLKTNPQLGVATEKVTDPQYFGTGLGIAVRPDNKALLEKLNNALAAIKADGTYQKISDQW
FPQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttagttcttgccgctttacttgcttcctttactttcggtgcttctgccgca
gagaaaatcaattttggcgtttcagccacctatccaccctttgaatctataggtgctaat
aatgagattgtcggctttgatatcgatctggcaaaagccttgtgcaaacaaatgcaggca
gaatgtacttttactaatcacgcgttcgacagcctgatcccgtccctgaaattcagaaaa
tatgacgccgtaatctccggtatggatatcaccccggagcgtagcaaacaggtatcgttt
accacgccctactatgaaaactcagccgtcgtgattgccaaaaaagatacctacaaaacg
tttgccgatctgaaaggcaaacgtattgggatggaaaacggtactacgcaccagaaatat
attcaggatcagcacccggaagtgaaaactgtctcttatgacagttatcagaatgccttt
atcgatctgaaaaatggtcgtattgatggggtatttggtgacacagcggtggtaaacgaa
tggctgaaaaccaatccacaacttggtgttgctactgagaaagtgaccgatccgcaatat
tttggcaccggcctgggcatcgctgtacgtccggataacaaagccctgctggaaaaactg
aataacgcgctggcagcaattaaagctgacggtacttatcaaaaaatcagtgaccagtgg
ttcccacagtaa

DBGET integrated database retrieval system