KEGG   Escherichia coli K-12 MG1655: b0871Help
Entry
b0871             CDS       T00007                                 

Gene name
poxB
Definition
(RefSeq) pyruvate oxidase
  KO
K00156  pyruvate dehydrogenase (quinone) [EC:1.2.5.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00620  Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    b0871 (poxB)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.5  With a quinone or similar compound as acceptor
    1.2.5.1  pyruvate dehydrogenase (quinone)
     b0871 (poxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M Ham1p_like PPS_PS
Motif
Other DBs
NCBI-GeneID: 946132
NCBI-ProteinID: NP_415392
Pasteur: poxB
RegulonDB: ECK120000745
ECOCYC: EG10754
ASAP: ABE-0002958
UniProt: P07003 A0A387CYG6
Structure
PDB: 

Position
complement(909331..911049)
Genome map
AA seq 572 aa AA seqDB search
MKQTVAAYIAKTLESAGVKRIWGVTGDSLNGLSDSLNRMGTIEWMSTRHEEVAAFAAGAE
AQLSGELAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAAHIPSSEIGSGYFQETHPQEL
FRECSHYCELVSSPEQIPQVLAIAMRKAVLNRGVSVVVLPGDVALKPAPEGATMHWYHAP
QPVVTPEEEELRKLAQLLRYSSNIALMCGSGCAGAHKELVEFAGKIKAPIVHALRGKEHV
EYDNPYDVGMTGLIGFSSGFHTMMNADTLVLLGTQFPYRAFYPTDAKIIQIDINPASIGA
HSKVDMALVGDIKSTLRALLPLVEEKADRKFLDKALEDYRDARKGLDDLAKPSEKAIHPQ
YLAQQISHFAADDAIFTCDVGTPTVWAARYLKMNGKRRLLGSFNHGSMANAMPQALGAQA
TEPERQVVAMCGDGGFSMLMGDFLSVVQMKLPVKIVVFNNSVLGFVAMEMKAGGYLTDGT
ELHDTNFARIAEACGITGIRVEKASEVDEALQRAFSIDGPVLVDVVVAKEELAIPPQIKL
EQAKGFSLYMLRAIISGRGDEVIELAKTNWLR
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaacggttgcagcttatatcgccaaaacactcgaatcggcaggggtgaaacgc
atctggggagtcacaggcgactctctgaacggtcttagtgacagtcttaatcgcatgggc
accatcgagtggatgtccacccgccacgaagaagtggcggcctttgccgctggcgctgaa
gcacaacttagcggagaactggcggtctgcgccggatcgtgcggccccggcaacctgcac
ttaatcaacggcctgttcgattgccaccgcaatcacgttccggtactggcgattgccgct
catattccctccagcgaaattggcagcggctatttccaggaaacccacccacaagagcta
ttccgcgaatgtagtcactattgcgagctggtttccagcccggagcagatcccacaagta
ctggcgattgccatgcgcaaagcggtgcttaaccgtggcgtttcggttgtcgtgttacca
ggcgacgtggcgttaaaacctgcgccagaaggggcaaccatgcactggtatcatgcgcca
caaccagtcgtgacgccggaagaagaagagttacgcaaactggcgcaactgctgcgttat
tccagcaatatcgccctgatgtgtggcagcggctgcgcgggggcgcataaagagttagtt
gagtttgccgggaaaattaaagcgcctattgttcatgccctgcgcggtaaagaacatgtc
gaatacgataatccgtatgatgttggaatgaccgggttaatcggcttctcgtcaggtttc
cataccatgatgaacgccgacacgttagtgctactcggcacgcaatttccctaccgcgcc
ttctacccgaccgatgccaaaatcattcagattgatatcaacccagccagcatcggcgct
cacagcaaggtggatatggcactggtcggcgatatcaagtcgactctgcgtgcattgctt
ccattggtggaagaaaaagccgatcgcaagtttctggataaagcgctggaagattaccgc
gacgcccgcaaagggctggacgatttagctaaaccgagcgagaaagccattcacccgcaa
tatctggcgcagcaaattagtcattttgccgccgatgacgctattttcacctgtgacgtt
ggtacgccaacggtgtgggcggcacgttatctaaaaatgaacggcaagcgtcgcctgtta
ggttcgtttaaccacggttcgatggctaacgccatgccgcaggcgctgggtgcgcaggcg
acagagccagaacgtcaggtggtcgccatgtgcggcgatggcggttttagcatgttgatg
ggcgatttcctctcagtagtgcagatgaaactgccagtgaaaattgtcgtctttaacaac
agcgtgctgggctttgtggcgatggagatgaaagctggtggctatttgactgacggcacc
gaactacacgacacaaactttgcccgcattgccgaagcgtgcggcattacgggtatccgt
gtagaaaaagcgtctgaagttgatgaagccctgcaacgcgccttctccatcgacggtccg
gtgttggtggatgtggtggtcgccaaagaagagttagccattccaccgcagatcaaactc
gaacaggccaaaggtttcagcctgtatatgctgcgcgcaatcatcagcggacgcggtgat
gaagtgatcgaactggcgaaaacaaactggctaaggtaa

DBGET integrated database retrieval system