KEGG   Escherichia coli K-12 MG1655: b0895
Entry
b0895             CDS       T00007                                 

Gene name
dmsB
Definition
(RefSeq) dimethyl sulfoxide reductase subunit B
  KO
K07307  anaerobic dimethyl sulfoxide reductase subunit B
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00920  Sulfur metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    b0895 (dmsB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0895 (dmsB)
Transporters [BR:eco02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   b0895 (dmsB)
SSDB
Motif
Pfam: Fer4_11 Fer4 Fer4_2 Fer4_9 Fer4_7 Fer4_6 Fer4_10 Fer4_4 Fer4_3 Fer4_21 Fer4_8 Fer4_17 Fer4_16 Fer4_13
Other DBs
NCBI-GeneID: 945507
NCBI-ProteinID: NP_415415
Pasteur: dmsB
RegulonDB: ECK120000227
ECOCYC: EG10233
ASAP: ABE-0003046
UniProt: P18776
Position
943414..944031
AA seq 205 aa
MTTQYGFFIDSSRCTGCKTCELACKDYKDLTPEVSFRRIYEYAGGDWQEDNGVWHQNVFA
YYLSISCNHCEDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNETK
GHMTKCDGCYDRVAEGKKPICVESCPLRALDFGPIDELRKKHGDLAAVAPLPRAHFTKPN
IVIKPNANSRPTGDTTGYLANPKEV
NT seq 618 nt   +upstreamnt  +downstreamnt
atgacaacccagtatggattttttattgattccagccgttgcaccggttgcaaaacctgc
gagctggcctgtaaagactacaaagatttgacgccagaagtcagcttccgccgcatttat
gaatatgctggcggcgactggcaggaagataacggtgtctggcaccagaacgtgtttgcc
tactatctgtcgatttcatgtaaccactgcgaagatccggcttgtactaaagtctgcccg
agcggtgcgatgcataaacgtgaagatggttttgttgtggtcgatgaagatgtgtgcatt
ggctgccgctactgccatatggcttgcccgtatggcgcaccgcaatataacgaaacgaaa
ggccatatgaccaaatgcgatggttgttatgaccgtgttgcggagggtaaaaagccgatc
tgtgttgaatcttgtccgctgcgggcgctggatttcggccctatcgacgagctgcgtaaa
aaacatggcgatctggcggccgttgcgccgttgccgcgagctcactttaccaaaccgaat
attgtgatcaaacccaatgccaatagccgcccgaccggggataccactggctatctggca
aacccgaaggaggtgtga

DBGET integrated database retrieval system