KEGG   Escherichia coli K-12 MG1655: b0898
Entry
b0898             CDS       T00007                                 
Symbol
ycaD
Name
(RefSeq) putative transporter YcaD
  KO
K08219  MFS transporter, UMF2 family, putative MFS family transporter protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0898 (ycaD)
Transporters [BR:eco02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Unknown major facilitator-2 (UMF2) [TC:2.A.1.26]
    b0898 (ycaD)
SSDB
Motif
Pfam: MFS_1 MFS_4 Sugar_tr MFS_1_like Nterm_IS4
Other DBs
NCBI-GeneID: 945515
NCBI-ProteinID: NP_415418
Pasteur: ycaD
RegulonDB: ECK120001219
ECOCYC: EG11242
ASAP: ABE-0003056
UniProt: P21503
Position
945871..947019
AA seq 382 aa
MSTYTQPVMLLLSGLLLLTLAIAVLNTLVPLWLAQEHMSTWQVGVVSSSYFTGNLVGTLL
TGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALM
CSGTSRNRGRLLAAYMMVYYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRV
LNQQAENHDSTSITSMLKLRQARLGVNGCIISGIVLGSLYGLMPLYLNHKGVSNASIGFW
MAVLVSAGILGQWPIGRLADKFGRLLVLRVQVFVVILGSIAMLSQAAMAPALFILGAAGF
TLYPVAMAWACEKVEHHQLVAMNQALLLSYTVGSLLGPSFTAMLMQNFSDNLLFIMIASV
SFIYLLMLLRNAGHTPKPVAHV
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgtccacgtatacccagcctgtcatgcttttgctgtctggcctgcttttgttgactctg
gcgattgcggtgttaaatacactcgtgccgctttggctcgcccaggaacacatgtccaca
tggcaggtaggcgttgtcagctcatcctattttaccggcaaccttgtcggtacattgctg
acagggtatgtcattaagcgcattggctttaaccgcagctattatctggcctccttcatt
tttgccgctggctgtgccggccttggcctgatgattggattctggagctggttggcttgg
cgttttgtcgcgggcgtcggctgtgccatgatttgggtggttgttgagagcgcgctgatg
tgcagtgggacgtcacgtaaccgtgggcgtttgcttgctgcgtatatgatggtttattac
gtgggaacgtttttaggccagttactggtcagcaaagtttcaaccgagctgatgtccgta
ttgccgtgggttacaggtttgacgttggcagggatcttaccgctgttgtttacgcgtgtg
ctgaatcagcaggctgaaaaccatgattcgacgtcaattacgtcaatgctaaaactccgt
caggcgcggcttggcgtgaatggctgcattatctcaggaatcgttctgggatctctatat
ggcctgatgccgctgtacctcaatcacaaaggggtgagcaatgccagcattggtttctgg
atggcggtactggtcagtgcgggtatccttggacaatggccgattggacgtctggcggat
aagtttggtcgactgctggtgttgcgtgttcaggtctttgtcgtcattctcggcagtatc
gcgatgcttagccaggcggcgatggccccagcgttattcatcctcggtgccgctggcttt
acgctatatccggtggcgatggcatgggcttgcgagaaagttgaacatcatcaactggtg
gcgatgaaccaggccttactgttgagctatactgtgggaagtctgcttggcccgtcattt
accgctatgctaatgcagaatttctccgataatttattgtttatcatgatcgccagcgta
tcgtttatctatttgctgatgctgctgcgcaacgccggtcatacgccgaaacccgttgct
cacgtgtaa

DBGET integrated database retrieval system