KEGG   Escherichia coli K-12 MG1655: b0903
Entry
b0903             CDS       T00007                                 

Gene name
pflB
Definition
(RefSeq) pyruvate formate-lyase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00620  Pyruvate metabolism
eco00640  Propanoate metabolism
eco00650  Butanoate metabolism
eco01100  Metabolic pathways
eco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    b0903 (pflB)
   00640 Propanoate metabolism
    b0903 (pflB)
   00650 Butanoate metabolism
    b0903 (pflB)
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     b0903 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-GeneID: 945514
NCBI-ProteinID: NP_415423
Pasteur: pflB
RegulonDB: ECK120000693
ECOCYC: EG10701
ASAP: ABE-0003071
UniProt: P09373
Structure
PDB: 

Position
complement(951272..953554)
AA seq 760 aa
MSELNEKLATAWEGFTKGDWQNEVNVRDFIQKNYTPYEGDESFLAGATEATTTLWDKVME
GVKLENRTHAPVDFDTAVASTITSHDAGYINKQLEKIVGLQTEAPLKRALIPFGGIKMIE
GSCKAYNRELDPMIKKIFTEYRKTHNQGVFDVYTPDILRCRKSGVLTGLPDAYGRGRIIG
DYRRVALYGIDYLMKDKLAQFTSLQADLENGVNLEQTIRLREEIAEQHRALGQMKEMAAK
YGYDISGPATNAQEAIQWTYFGYLAAVKSQNGAAMSFGRTSTFLDVYIERDLKAGKITEQ
EAQEMVDHLVMKLRMVRFLRTPEYDELFSGDPIWATESIGGMGLDGRTLVTKNSFRFLNT
LYTMGPSPEPNMTILWSEKLPLNFKKFAAKVSIDTSSLQYENDDLMRPDFNNDDYAIACC
VSPMIVGKQMQFFGARANLAKTMLYAINGGVDEKLKMQVGPKSEPIKGDVLNYDEVMERM
DHFMDWLAKQYITALNIIHYMHDKYSYEASLMALHDRDVIRTMACGIAGLSVAADSLSAI
KYAKVKPIRDEDGLAIDFEIEGEYPQFGNNDPRVDDLAVDLVERFMKKIQKLHTYRDAIP
TQSVLTITSNVVYGKKTGNTPDGRRAGAPFGPGANPMHGRDQKGAVASLTSVAKLPFAYA
KDGISYTFSIVPNALGKDDEVRKTNLAGLMDGYFHHEASIEGGQHLNVNVMNREMLLDAM
ENPEKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTQSM
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgtccgagcttaatgaaaagttagccacagcctgggaaggttttaccaaaggtgactgg
cagaatgaagtaaacgtccgtgacttcattcagaaaaactacactccgtacgagggtgac
gagtccttcctggctggcgctactgaagcgaccaccaccctgtgggacaaagtaatggaa
ggcgttaaactggaaaaccgcactcacgcgccagttgactttgacaccgctgttgcttcc
accatcacctctcacgacgctggctacatcaacaagcagcttgagaaaatcgttggtctg
cagactgaagctccgctgaaacgtgctcttatcccgttcggtggtatcaaaatgatcgaa
ggttcctgcaaagcgtacaaccgcgaactggatccgatgatcaaaaaaatcttcactgaa
taccgtaaaactcacaaccagggcgtgttcgacgtttacactccggacatcctgcgttgc
cgtaaatctggtgttctgaccggtctgccagatgcatatggccgtggccgtatcatcggt
gactaccgtcgcgttgcgctgtacggtatcgactacctgatgaaagacaaactggcacag
ttcacttctctgcaggctgatctggaaaacggcgtaaacctggaacagactatccgtctg
cgcgaagaaatcgctgaacagcaccgcgctctgggtcagatgaaagaaatggctgcgaaa
tacggctacgacatctctggtccggctaccaacgctcaggaagctatccagtggacttac
ttcggctacctggctgctgttaagtctcagaacggtgctgcaatgtccttcggtcgtacc
tccaccttcctggatgtgtacatcgaacgtgacctgaaagctggcaagatcaccgaacaa
gaagcgcaggaaatggttgaccacctggtcatgaaactgcgtatggttcgcttcctgcgt
actccggaatacgatgaactgttctctggcgacccgatctgggcaaccgaatctatcggt
ggtatgggcctcgacggtcgtaccctggttaccaaaaacagcttccgtttcctgaacacc
ctgtacaccatgggtccgtctccggaaccgaacatgaccattctgtggtctgaaaaactg
ccgctgaacttcaagaaattcgccgctaaagtgtccatcgacacctcttctctgcagtat
gagaacgatgacctgatgcgtccggacttcaacaacgatgactacgctattgcttgctgc
gtaagcccgatgatcgttggtaaacaaatgcagttcttcggtgcgcgtgcaaacctggcg
aaaaccatgctgtacgcaatcaacggcggcgttgacgaaaaactgaaaatgcaggttggt
ccgaagtctgaaccgatcaaaggcgatgtcctgaactatgatgaagtgatggagcgcatg
gatcacttcatggactggctggctaaacagtacatcactgcactgaacatcatccactac
atgcacgacaagtacagctacgaagcctctctgatggcgctgcacgaccgtgacgttatc
cgcaccatggcgtgtggtatcgctggtctgtccgttgctgctgactccctgtctgcaatc
aaatatgcgaaagttaaaccgattcgtgacgaagacggtctggctatcgacttcgaaatc
gaaggcgaatacccgcagtttggtaacaatgatccgcgtgtagatgacctggctgttgac
ctggtagaacgtttcatgaagaaaattcagaaactgcacacctaccgtgacgctatcccg
actcagtctgttctgaccatcacttctaacgttgtgtatggtaagaaaacgggtaacacc
ccagacggtcgtcgtgctggcgcgccgttcggaccgggtgctaacccgatgcacggtcgt
gaccagaaaggtgcagtagcctctctgacttccgttgctaaactgccgtttgcttacgct
aaagatggtatctcctacaccttctctatcgttccgaacgcactgggtaaagacgacgaa
gttcgtaagaccaacctggctggtctgatggatggttacttccaccacgaagcatccatc
gaaggtggtcagcacctgaacgttaacgtgatgaaccgtgaaatgctgctcgacgcgatg
gaaaacccggaaaaatatccgcagctgaccatccgtgtatctggctacgcagtacgtttc
aactcgctgactaaagaacagcagcaggacgttattactcgtaccttcactcaatctatg
taa

DBGET integrated database retrieval system