KEGG   Escherichia coli K-12 MG1655: b0904
Entry
b0904             CDS       T00007                                 

Symbol
focA
Name
(RefSeq) formate channel FocA
  KO
K06212  formate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0904 (focA)
Transporters [BR:eco02000]
 Other transporters
  Pores ion channels [TC:1]
   b0904 (focA)
SSDB
Motif
Pfam: Form_Nir_trans
Other DBs
NCBI-GeneID: 945513
NCBI-ProteinID: NP_415424
Pasteur: focA
RegulonDB: ECK120001233
ECOCYC: EG11258
ASAP: ABE-0003073
UniProt: P0AC23
Structure
PDB: 
3KCU 3KCV

Position
complement(953609..954466)
AA seq 285 aa
MKADNPFDLLLPAAMAKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITATTGTG
TMPFGMAKLVGGICFSLGLILCVVCGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFG
NLVGALLFVLLMWLSGEYMTANGQWGLNVLQTADHKVHHTFIEAVCLGILANLMVCLAVW
MSYSGRSLMDKAFIMVLPVAMFVASGFEHSIANMFMIPMGIVIRDFASPEFWTAVGSAPE
NFSHLTVMNFITDNLIPVTIGNIIGGGLLVGLTYWVIYLRENDHH
NT seq 858 nt   +upstreamnt  +downstreamnt
gtgaaagctgacaacccttttgatcttttacttcctgctgcaatggccaaagtggccgaa
gaggcgggtgtctataaagcaacgaaacatccgcttaagactttctatctggcgattacc
gccggtgttttcatctcaatcgcattcgtcttctatatcacagcaaccactggcacaggc
acaatgcccttcggcatggcaaaactggttggcggcatttgcttctctctggggctgatt
ctttgtgttgtctgcggagccgatctctttacttccaccgtgttgattgttgttgctaag
gcgagtgggcgcatcacctggggtcagttggcgaaaaactggctaaatgtctattttggc
aacctggtcggcgcactgctgtttgtacttttaatgtggctttccggcgagtatatgacc
gcaaatggtcaatggggactaaacgtcctacaaaccgccgaccacaaagtgcaccatact
tttattgaggccgtctgtcttggtatcctggcaaacctgatggtatgtctggcagtatgg
atgagttattctggccgcagcctgatggacaaagcgttcattatggtgctgccggtcgcg
atgtttgttgccagcggttttgagcacagtatcgcaaacatgtttatgatcccgatgggt
attgtaatccgcgacttcgcatccccggaattttggaccgcagtcggttctgcaccggaa
aatttttctcacctgaccgtgatgaatttcatcactgataacctgattccggttacgatc
ggcaacattatcggtggtggtttgttggttgggttgacatactgggtcatttacctgcgt
gaaaacgaccaccattaa

DBGET integrated database retrieval system