KEGG   Escherichia coli K-12 MG1655: b0908Help
Entry
b0908             CDS       T00007                                 

Gene name
aroA
Definition
(RefSeq) 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01130  Biosynthesis of antibiotics
eco01230  Biosynthesis of amino acids
Module
eco_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    b0908 (aroA)
Enzymes [BR:eco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     b0908 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-GeneID: 945528
NCBI-ProteinID: NP_415428
Pasteur: aroA
RegulonDB: ECK120000069
ECOCYC: EG10073
ASAP: ABE-0003095
UniProt: P0A6D3
Structure
PDB: 

Position
958812..960095
Genome map
AA seq 427 aa AA seqDB search
MESLTLQPIARVDGTINLPGSKSVSNRALLLAALAHGKTVLTNLLDSDDVRHMLNALTAL
GVSYTLSADRTRCEIIGNGGPLHAEGALELFLGNAGTAMRPLAAALCLGSNDIVLTGEPR
MKERPIGHLVDALRLGGAKITYLEQENYPPLRLQGGFTGGNVDVDGSVSSQFLTALLMTA
PLAPEDTVIRIKGDLVSKPYIDITLNLMKTFGVEIENQHYQQFVVKGGQSYQSPGTYLVE
GDASSASYFLAAAAIKGGTVKVTGIGRNSMQGDIRFADVLEKMGATICWGDDYISCTRGE
LNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVE
EGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQL
ARISQAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaatccctgacgttacaacccatcgctcgtgtcgatggcactattaatctgcccggt
tccaagagcgtttctaaccgcgctttattgctggcggcattagcacacggcaaaacagta
ttaaccaatctgctggatagcgatgacgtgcgccatatgctgaatgcattaacagcgtta
ggggtaagctatacgctttcagccgatcgtacgcgttgcgaaattatcggtaacggcggt
ccattacacgcagaaggtgccctggagttgttcctcggtaacgccggaacggcaatgcgt
ccgctggcggcagctctttgtctgggtagcaatgatattgtgctgaccggtgagccgcgt
atgaaagaacgcccgattggtcatctggtggatgcgctgcgcctgggcggggcgaagatc
acttacctggaacaagaaaattatccgccgttgcgtttacagggcggctttactggcggc
aacgttgacgttgatggctccgtttccagccaattcctcaccgcactgttaatgactgcg
cctcttgcgccggaagatacggtgattcgtattaaaggcgatctggtttctaaaccttat
atcgacatcacactcaatctgatgaagacgtttggtgttgaaattgaaaatcagcactat
caacaatttgtcgtaaaaggcgggcagtcttatcagtctccgggtacttatttggtcgaa
ggcgatgcatcttcggcttcttactttctggcagcagcagcaatcaaaggcggcactgta
aaagtgaccggtattggacgtaacagtatgcagggtgatattcgctttgctgatgtgctg
gaaaaaatgggcgcgaccatttgctggggcgatgattatatttcctgcacgcgtggtgaa
ctgaacgctattgatatggatatgaaccatattcctgatgcggcgatgaccattgccacg
gcggcgttatttgcaaaaggcaccaccacgctgcgcaatatctataactggcgtgttaaa
gagaccgatcgcctgtttgcgatggcaacagaactgcgtaaagtcggcgcggaagtggaa
gaggggcacgattacattcgtatcactcctccggaaaaactgaactttgccgagatcgcg
acatacaatgatcaccggatggcgatgtgtttctcgctggtggcgttgtcagatacacca
gtgacgattcttgatcccaaatgcacggccaaaacatttccggattatttcgagcagctg
gcgcggattagccaggcagcctga

DBGET integrated database retrieval system