KEGG   Escherichia coli K-12 MG1655: b0928Help
Entry
b0928             CDS       T00007                                 

Gene name
aspC
Definition
(RefSeq) aspartate aminotransferase, PLP-dependent
  KO
K00813  aspartate aminotransferase [EC:2.6.1.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00220  Arginine biosynthesis
eco00250  Alanine, aspartate and glutamate metabolism
eco00270  Cysteine and methionine metabolism
eco00330  Arginine and proline metabolism
eco00350  Tyrosine metabolism
eco00360  Phenylalanine metabolism
eco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eco00401  Novobiocin biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01130  Biosynthesis of antibiotics
eco01210  2-Oxocarboxylic acid metabolism
eco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    b0928 (aspC)
   00270 Cysteine and methionine metabolism
    b0928 (aspC)
   00220 Arginine biosynthesis
    b0928 (aspC)
   00330 Arginine and proline metabolism
    b0928 (aspC)
   00350 Tyrosine metabolism
    b0928 (aspC)
   00360 Phenylalanine metabolism
    b0928 (aspC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    b0928 (aspC)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    b0928 (aspC)
Enzymes [BR:eco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     b0928 (aspC)
Amino acid related enzymes [BR:eco01007]
 Aminotransferase (transaminase)
  Class I
   b0928 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 945553
NCBI-ProteinID: NP_415448
Pasteur: aspC
RegulonDB: ECK120000092
ECOCYC: EG10096
ASAP: ABE-0003150
UniProt: P00509
Structure
PDB: 

Position
complement(984519..985709)
Genome map
AA seq 396 aa AA seqDB search
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENE
TTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSV
KRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGC
CHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIV
ASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN
DALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLR
LREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagaacattaccgccgctcctgccgacccgattctgggcctggccgatctgttt
cgtgccgatgaacgtcccggcaaaattaacctcgggattggtgtctataaagatgagacg
ggcaaaaccccggtactgaccagcgtgaaaaaggctgaacagtatctgctcgaaaatgaa
accaccaaaaattacctcggcattgacggcatccctgaatttggtcgctgcactcaggaa
ctgctgtttggtaaaggtagcgccctgatcaatgacaaacgtgctcgcacggcacagact
ccggggggcactggcgcactacgcgtggctgccgatttcctggcaaaaaataccagcgtt
aagcgtgtgtgggtgagcaacccaagctggccgaaccataagagcgtctttaactctgca
ggtctggaagttcgtgaatacgcttattatgatgcggaaaatcacactcttgacttcgat
gcactgattaacagcctgaatgaagctcaggctggcgacgtagtgctgttccatggctgc
tgccataacccaaccggtatcgaccctacgctggaacaatggcaaacactggcacaactc
tccgttgagaaaggctggttaccgctgtttgacttcgcttaccagggttttgcccgtggt
ctggaagaagatgctgaaggactgcgcgctttcgcggctatgcataaagagctgattgtt
gccagttcctactctaaaaactttggcctgtacaacgagcgtgttggcgcttgtactctg
gttgctgccgacagtgaaaccgttgatcgcgcattcagccaaatgaaagcggcgattcgc
gctaactactctaacccaccagcacacggcgcttctgttgttgccaccatcctgagcaac
gatgcgttacgtgcgatttgggaacaagagctgactgatatgcgccagcgtattcagcgt
atgcgtcagttgttcgtcaatacgctgcaggaaaaaggcgcaaaccgcgacttcagcttt
atcatcaaacagaacggcatgttctccttcagtggcctgacaaaagaacaagtgctgcgt
ctgcgcgaagagtttggcgtatatgcggttgcttctggtcgcgtaaatgtggccgggatg
acaccagataacatggctccgctgtgcgaagcgattgtggcagtgctgtaa

DBGET integrated database retrieval system