KEGG   Escherichia coli K-12 MG1655: b0933
Entry
b0933             CDS       T00007                                 

Gene name
ssuB
Definition
(RefSeq) aliphatic sulfonate ABC transporter ATP binding subunit
  KO
K15555  sulfonate transport system ATP-binding protein [EC:7.6.2.14]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00920  Sulfur metabolism
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    b0933 (ssuB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b0933 (ssuB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0933 (ssuB)
Enzymes [BR:eco01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.14  ABC-type aliphatic sulfonate transporter
     b0933 (ssuB)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfonate transporter
    b0933 (ssuB)
SSDB
Motif
Pfam: ABC_tran AAA_22 AAA_33 AAA_28 AAA_21 SMC_N RsgA_GTPase MMR_HSR1 AAA_16 AAA_30 AAA_29 AAA_25 NB-ARC DLIC
Other DBs
NCBI-GeneID: 947220
NCBI-ProteinID: NP_415453
Pasteur: ycbE
RegulonDB: ECK120002226
ECOCYC: EG12358
ASAP: ABE-0003173
UniProt: P0AAI1
Position
complement(993277..994044)
AA seq 255 aa
MNTARLNQGTPLLLNAVSKHYAENIVLNQLDLHIPAGQFVAVVGRSGGGKSTLLRLLAGL
ETPTAGDVLAGTTPLAEIQEDTRMMFQDARLLPWKSVIDNVGLGLKGQWRDAARRALAAV
GLENRAGEWPAALSGGQKQRVALARALIHRPGLLLLDEPLGALDALTRLEMQDLIVSLWQ
EHGFTVLLVTHDVSEAVAMADRVLLIEEGKIGLDLTVDIPRPRRLGSVRLAELEAEVLQR
VMQRGESETRLRKQG
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaatactgctcgtctgaaccagggcacgccattgttgctcaatgcagtaagcaaacat
tacgcggaaaatatcgtcctgaaccaactggatttacatattccggcaggtcagtttgtg
gcggtggtgggccgcagcggtggtggcaaaagtaccctgctgcgcctgctggcaggtctg
gaaacgccaaccgcaggcgatgtgttagcgggcaccacaccgctggctgaaattcaggaa
gacacgcgaatgatgtttcaggatgcgcgtctgctaccgtggaaatcggtgattgataac
gttgggttaggccttaaaggccagtggcgcgatgccgcacgtcgagcgttggctgcggta
ggactggagaatcgcgcaggggaatggcctgccgcactttctggcgggcagaaacagcga
gtggcgctggcaagagcgttgattcatcgaccgggattattgttgcttgatgaaccgctc
ggggcgctggacgccttaacgcgactcgagatgcaggatttgattgtgtcactttggcag
gagcacggctttaccgtactgttggtgacgcatgatgtgagcgaagcggtagcgatggct
gaccgggtgctgttaattgaagagggaaaaattggtctggatttgacagtggatatcccc
cgtccgcgtcgattagggtcggtgcgattagcggagctggaagcggaggtgttgcaacgg
gtgatgcaacgtggtgaatctgaaactcgcctgagaaaacaggggtaa

DBGET integrated database retrieval system