KEGG   Escherichia coli K-12 MG1655: b0934
Entry
b0934             CDS       T00007                                 

Gene name
ssuC
Definition
(RefSeq) aliphatic sulfonate ABC transporter membrane subunit
  KO
K15554  sulfonate transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00920  Sulfur metabolism
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    b0934 (ssuC)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b0934 (ssuC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0934 (ssuC)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfonate transporter
    b0934 (ssuC)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 947216
NCBI-ProteinID: NP_415454
Pasteur: ycbM
RegulonDB: ECK120003076
ECOCYC: G6476
ASAP: ABE-0003175
UniProt: P75851
Position
complement(994041..994832)
AA seq 263 aa
MATPVKKWLLRVAPWFLPVGIVAVWQLASSVGWLSTRILPSPEGVVTAFWTLSASGELWQ
HLAISSWRALIGFSIGGSLGLILGLISGLSRWGERLLDTSIQMLRNVPHLALIPLVILWF
GIDESAKIFLVALGTLFPIYINTWHGIRNIDRGLVEMARSYGLSGIPLFIHVILPGALPS
IMVGVRFALGLMWLTLIVAETISANSGIGYLAMNAREFLQTDVVVVAIILYALLGKLADV
SAQLLERLWLRWNPAYHLKEATV
NT seq 792 nt   +upstreamnt  +downstreamnt
atggcaacgccagtgaagaagtggttattgcgcgttgccccctggtttttaccggtgggc
atcgtggcggtgtggcaactggcctcctcggttggctggctgtcgacgcgtattttgcct
tcaccggaaggagtggtgacggcgttctggacgctctccgccagcggcgaactgtggcag
catctggcgatcagctcctggcgggcgctgattggcttttcaattggcggatcgctgggg
ttgattttgggactgattagcgggctatctcgctggggagaacggctgctggatacctca
attcagatgttgcgcaacgtgccgcatctggcgctgatcccgctggtgattttgtggttt
ggcattgatgaatccgcaaaaatctttctggtggcgctcggtacgctattccccatttat
atcaacacctggcatggcatccgtaatatcgatcgcgggttggtggagatggcgcgtagc
tatggattatccggcataccgctgtttatccatgtgatcctgcctggtgccctgccctca
attatggtcggcgtgcgttttgcgttgggcctgatgtggctgacgctgattgttgccgaa
accatttctgccaattcaggcattggttatctggcgatgaatgcgcgggagtttttgcaa
acggacgtggtggtagtcgctattattctttacgccctgctcggcaaactggctgacgtc
agcgcgcagctgttagagcgcctctggttgcgctggaacccggcttatcatttgaaggag
gccacggtatga

DBGET integrated database retrieval system