KEGG   Escherichia coli K-12 MG1655: b0936
Entry
b0936             CDS       T00007                                 

Gene name
ssuA
Definition
(RefSeq) aliphatic sulfonate ABC transporter periplasmic binding protein
  KO
K15553  sulfonate transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00920  Sulfur metabolism
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    b0936 (ssuA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b0936 (ssuA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0936 (ssuA)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfonate transporter
    b0936 (ssuA)
SSDB
Motif
Pfam: SBP_bac_3 NMT1 NMT1_2 OpuAC Phosphonate-bd NMT1_3 LysR_substrate
Other DBs
NCBI-GeneID: 945560
NCBI-ProteinID: NP_415456
Pasteur: ycbO
RegulonDB: ECK120003078
ECOCYC: G6478
ASAP: ABE-0003180
UniProt: P75853
Structure
PDB: 
2X26

Position
complement(995985..996944)
AA seq 319 aa
MRNIIKLALAGLLSVSTFAVAAESSPEALRIGYQKGSIGMVLAKSHQLLEKRYPESKISW
VEFPAGPQMLEALNVGSIDLGSTGDIPPIFAQAAGADLVYVGVEPPKPKAEVILVAENSP
IKTVADLKGHKVAFQKGSSSHNLLLRALRQAGLKFTDIQPTYLTPADARAAFQQGNVDAW
AIWDPYYSAALLQGGVRVLKDGTDLNQTGSFYLAARPYAEKNGAFIQGVLATFSEADALT
RSQREQSIALLAKTMGLPAPVIASYLDHRPPTTIKPVNAEVAALQQQTADLFYENRLVPK
KVDIRQRIWQPTQLEGKQL
NT seq 960 nt   +upstreamnt  +downstreamnt
atgcgtaacatcattaaactggcgctggcgggattgcttagcgtctctacttttgcggtt
gctgcagaatcctcgcctgaagcgttacgtataggctatcagaaaggcagtattggtatg
gtgctggcaaaaagccaccagttactggaaaaacgctatccggaatcaaaaatctcctgg
gtggagttccccgcgggtccgcaaatgttggaagcgttaaacgttggcagtattgatctc
ggcagtaccggggatattccgccaatctttgcccaggctgccggggctgatttggtgtac
gtgggcgtcgagccaccgaagcccaaagccgaagtgattctggtggcagaaaacagcccg
atcaaaaccgtagccgatcttaaaggtcacaaagttgcctttcagaaaggttccagttca
cacaaccttttactgcgtgcactgcgtcaggccggacttaagtttaccgatatccaaccc
acttacctgacgcccgctgatgcccgcgccgcgttccagcaaggtaacgttgacgcctgg
gctatctgggatccctactactctgctgcattattacagggcggcgtgcgggtgctgaaa
gacggcaccgatctcaatcaaactggatcgttttatctggcagctcgtccctatgcagaa
aaaaacggcgcttttattcagggcgtactggcaacctttagtgaggccgatgcgttaacc
cgcagccagcgcgagcaaagcatcgctttactggcaaaaacgatgggcttaccggcaccg
gtgattgcctcttacttagatcatcgccctcctaccaccatcaaaccggttaacgccgag
gttgccgccttacagcagcaaacggcagatctgttttatgaaaatcgtctggtgccgaaa
aaagtcgatattcgccagcgcatctggcagcccactcaactggaaggaaaacaattatga

DBGET integrated database retrieval system