KEGG   Escherichia coli K-12 MG1655: b0967Help
Entry
b0967             CDS       T00007                                 

Gene name
rlmI
Definition
(RefSeq) 23S rRNA m(5)C1962 methyltransferase, SAM-dependent
  KO
K06969  23S rRNA (cytosine1962-C5)-methyltransferase [EC:2.1.1.191]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:eco03009]
    b0967 (rlmI)
Enzymes [BR:eco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.191  23S rRNA (cytosine1962-C5)-methyltransferase
     b0967 (rlmI)
Ribosome biogenesis [BR:eco03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    b0967 (rlmI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltrans_SAM Cons_hypoth95 Methyltransf_31 MTS Methyltransf_25 Met_10 Methyltransf_15 PrmA Methyltransf_11 TRM PUA Methyltransf_10 Methyltransf_12 Methyltr_RsmB-F
Motif
Other DBs
NCBI-GeneID: 946691
NCBI-ProteinID: NP_415487
RegulonDB: ECK120003101
ECOCYC: G6501
ASAP: ABE-0003272
UniProt: P75876
Structure
PDB: 

Position
complement(1028779..1029969)
Genome map
AA seq 396 aa AA seqDB search
MSVRLVLAKGREKSLLRRHPWVFSGAVARMEGKASLGETIDIVDHQGKWLARGAYSPASQ
IRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGLPGITIDRF
GNFLVLQLLSAGAEYQRAALISALQTLYPECSIYDRSDVAVRKKEGMELTQGPVTGELPP
ALLPIEEHGMKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYTGGFAVSALM
GGCSQVVSVDTSQEALDIARQNVELNKLDLSKAEFVRDDVFKLLRTYRDRGEKFDVIVMD
PPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLFQKIIADAAIDA
GRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtacgtttagtgttagccaaagggcgcgaaaaatcattacttcgtcgccatccg
tgggtcttttccggggccgttgcccgcatggaaggtaaagccagcctcggtgaaaccatc
gatattgttgatcatcagggaaaatggttagcacgcggcgcttattcgccagcttcgcaa
atccgggcgcgcgtctggacgtttgacccgtctgagtctatcgacattgcttttttttcc
cgccgtttgcaacaagcacaaaaatggcgtgactggctggcgcaaaaagatggcctcgac
agctatcgtttaatcgccggagaatctgatggcctgccgggtattactatcgatcgtttc
ggtaattttctggtgctgcaactgctgagtgctggggcagaatatcagcgcgcggcatta
attagtgccctgcaaacgctgtacccggaatgttcgatttacgatcgcagcgacgtcgcg
gtacgtaaaaaagaaggaatggagctgacccagggccccgtcaccggcgagttgccacct
gccctgctgccgattgaagaacacggaatgaaactgctggtggatattcagcacggacac
aaaacgggctactacctggaccagcgtgatagccgcctggctacccgccgctacgttgaa
aataaacgtgtgctgaactgtttctcctataccggtggtttcgccgtatcggcactgatg
ggcggttgcagccaggttgtcagcgttgatacctcccaggaagcgctggatattgcacgg
cagaacgttgagctgaacaaactggatctgagcaaggctgagtttgtccgtgatgatgtc
tttaaattgctgcgtacttatcgcgatcgcggtgaaaaatttgacgttatcgtgatggac
ccgccgaagtttgttgagaataaaagccagttgatgggcgcgtgtcgtggttataaagac
atcaacatgctggcgattcagctgctgaatgaaggcggtattctcctgactttctcctgt
tccggtctgatgaccagcgatttatttcagaaaatcatcgcggatgccgcaattgatgcc
ggtcgtgatgtacaatttatagagcagttccgtcaggcagccgatcatccggtgatcgct
acctatccggaagggctatatctgaaagggtttgcctgtcgcgtcatgtaa

DBGET integrated database retrieval system