KEGG   Escherichia coli K-12 MG1655: b0969Help
Entry
b0969             CDS       T00007                                 

Gene name
tusE
Definition
(RefSeq) sulfur transfer protein TusE
  KO
K11179  tRNA 2-thiouridine synthesizing protein E [EC:2.8.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    b0969 (tusE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eco03016]
    b0969 (tusE)
Enzymes [BR:eco01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.-  
     b0969 (tusE)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic type
  tRNA modification factors
   Thiolation factors
    b0969 (tusE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsrC Staph_opine_DH
Motif
Other DBs
NCBI-GeneID: 945023
NCBI-ProteinID: NP_415489
Pasteur: yccK
RegulonDB: ECK120002415
ECOCYC: EG12876
ASAP: ABE-0003278
UniProt: P0AB18
Position
complement(1030339..1030668)
Genome map
AA seq 109 aa AA seqDB search
MLIFEGKEIETDTEGYLKESSQWSEPLAVVIAENEGISLSPEHWEVVRFVRDFYLEFNTS
PAIRMLVKAMANKFGEEKGNSRYLYRLFPKGPAKQATKIAGLPKPVKCI
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcttcgaaggtaaagagatagaaacggataccgaaggctatctcaaagaaagc
agccagtggagtgagccgctggctgtggtgattgcagagaacgaagggatttcgctgtca
ccggaacactgggaagtggtgcgttttgtgcgtgatttctatctggaattcaatacttct
ccggcgattcgtatgctggtaaaagcgatggcgaataaatttggcgaagaaaaaggtaac
agccgctatttataccgactgtttccgaaaggtccggctaagcaagccaccaaaattgct
ggcctgccaaaaccggtaaaatgtatttaa

DBGET integrated database retrieval system