KEGG   Escherichia coli K-12 MG1655: b1013
Entry
b1013             CDS       T00007                                 

Gene name
rutR
Definition
(RefSeq) DNA-binding transcriptional dual regulator RutR
  KO
K09017  TetR/AcrR family transcriptional regulator
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eco03000]
    b1013 (rutR)
Transcription factors [BR:eco03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    b1013 (rutR)
SSDB
Motif
Pfam: TetR_C_3 TetR_N TetR_C_29
Other DBs
NCBI-GeneID: 945075
NCBI-ProteinID: NP_415533
Pasteur: ycdC
RegulonDB: ECK120002180
ECOCYC: EG12301
ASAP: ABE-0003422
UniProt: P0ACU2
Structure
PDB: 
4JYK 4XK4 4X1E 3LOC

Position
1074242..1074880
AA seq 212 aa
MTQGAVKTTGKRSRAVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFP
SKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEML
AGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQV
EAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
NT seq 639 nt   +upstreamnt  +downstreamnt
atgacgcaaggcgcagtgaaaacaacgggtaaacgttcgcgcgcagtaagcgcgaagaaa
aaagcgattcttagcgcagcactggacactttttcacaattcggttttcacggcacaagg
ctggagcagatcgcagagttggcgggtgtttcaaaaaccaatctgctgtattactttccg
tcaaaagaggcgctgtatattgccgtgctgcggcagattctcgatatctggctggcaccg
ttaaaagcgtttcgtgaagatttcgccccgctggcggcgatcaaagagtacatccgtctg
aagctggaagtctcacgcgattatccgcaggcttcgcgcctgttctgtatggagatgctg
gcaggcgcgccgctgttaatggatgaactgacgggcgatttgaaggcattaattgatgag
aaatcggcgctgattgccggttgggtcaaaagcggcaaactcgcgccgattgatccgcag
catttgatttttatgatttgggcttccactcaacattacgccgatttcgcccctcaggtg
gaggcggtgacaggcgcgacgttgcgcgatgaggtatttttcaatcaaacggttgaaaac
gtgcagcggattattattgaggggattcgaccacgttaa

DBGET integrated database retrieval system