KEGG   Escherichia coli K-12 MG1655: b1023Help
Entry
b1023             CDS       T00007                                 

Gene name
pgaB
Definition
(RefSeq) poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase and beta-1,6 glycoside hydrolase
  KO
K11931  poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase [EC:3.5.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:eco00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    b1023 (pgaB)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     b1023 (pgaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHL13 Polysacc_deac_1 GHL10
Motif
Other DBs
NCBI-GeneID: 945604
NCBI-ProteinID: NP_415542
Pasteur: ycdR
RegulonDB: ECK120003128
ECOCYC: G6530
ASAP: ABE-0003467
UniProt: P75906
Structure
PDB: 

Position
complement(1087839..1089857)
Genome map
AA seq 672 aa AA seqDB search
MLRNGNKYLLMLVSIIMLTACISQSRTSFIPPQDRESLLAEQPWPHNGFVAISWHNVEDE
AADQRFMSVRTSALREQFAWLRENGYQPVSIAQIREAHRGGKPLPEKAVVLTFDDGYQSF
YTRVFPILQAFQWPAVWAPVGSWVDTPADKQVKFGDELVDREYFATWQQVREVARSRLVE
LASHTWNSHYGIQANATGSLLPVYVNRAYFTDHARYETAAEYRERIRLDAVKMTEYLRTK
VEVNPHVFVWPYGEANGIAIEELKKLGYDMFFTLESGLANASQLDSIPRVLIANNPSLKE
FAQQIITVQEKSPQRIMHIDLDYVYDENLQQMDRNIDVLIQRVKDMQISTVYLQAFADPD
GDGLVKEVWFPNRLLPMKADIFSRVAWQLRTRSGVNIYAWMPVLSWDLDPTLTRVKYLPT
GEKKAQIHPEQYHRLSPFDDRVRAQVGMLYEDLAGHAAFDGILFHDDALLSDYEDASAPA
ITAYQQAGFSGSLSEIRQNPEQFKQWARFKSRALTDFTLELSARVKAIRGPHIKTARNIF
ALPVIQPESEAWFAQNYADFLKSYDWTAIMAMPYLEGVAEKSADQWLIQLTNQIKNIPQA
KDKSILELQAQNWQKNGQHQAISSQQLAHWMSLLQLNGVKNYGYYPDNFLHNQPEIDLIR
PEFSTAWYPKND
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtaatggaaataaatatctcctgatgctggtgagtataattatgctcaccgcg
tgcattagccagtcaagaacatcatttataccgccacaggatcgcgaatctttactcgcc
gagcaaccgtggccgcataatggttttgtagcgatttcatggcataacgttgaagacgaa
gctgccgaccagcgttttatgtcagtgcggacatcagcactgcgtgaacaatttgcctgg
ctgcgcgagaacggttatcaaccggtcagtattgctcaaattcgtgaagcacatcgagga
ggaaaaccgctaccggaaaaagctgtagtgctgacttttgatgacggctaccagagtttt
tatacccgcgtcttcccaattcttcaggccttccagtggcctgctgtatgggcccccgtc
ggcagttgggtcgatacgccagcggataaacaagtaaaatttggcgatgagttggtcgat
cgagaatattttgccacgtggcaacaagtgcgagaagttgcgcgttcccggctcgttgag
ctcgcttctcatacatggaattctcactacggtattcaggctaatgccaccggcagctta
ttgcctgtatatgtaaatcgtgcatattttactgaccacgcacggtatgaaaccgcagca
gaataccgggaaagaattcgtctggatgctgtaaaaatgacggaatacctgcgtacaaag
gttgaggtaaatccacacgtttttgtttggccttatggcgaagcgaatggcatagcgata
gaggaattaaaaaaactcggttatgacatgttcttcacccttgaatcaggtttggcaaat
gcgtcgcaattggattccattccgcgggtattaatcgccaataatccctcattaaaagag
tttgcccagcaaattattaccgtacaggaaaaatcaccacaacggataatgcatatcgat
cttgattacgtttatgacgaaaacctccagcaaatggatcgcaatattgatgtgctaatt
cagcgggtgaaagatatgcaaatatcaaccgtgtatttgcaggcatttgctgatcccgat
ggtgatgggctggtcaaagaggtctggtttccaaatcgtttgctaccaatgaaagcagat
atttttagtcgggttgcctggcaattacgtacccgctcaggtgtaaacatctatgcgtgg
atgccggtattaagctgggatttagatcccacattaacgcgagtaaaatacttaccaaca
ggggagaaaaaagcacaaattcatcctgaacaatatcaccgtctctctcctttcgatgac
agagtcagagcacaagttggcatgttatatgaagatcttgccggacatgctgcttttgat
ggcatattgttccacgatgatgctttgctttcagattatgaagatgccagtgcaccggct
atcacggcttatcagcaagcaggctttagcgggagtctgagcgaaattcgacaaaacccg
gagcaatttaaacagtgggcccgctttaaaagtcgtgcgttaactgacttcactttagaa
cttagtgcgcgcgtaaaagccattcgcggtccacatattaaaactgcacgaaatattttt
gcacttccggtaatacaacctgaaagtgaagcctggtttgcacagaattatgctgatttc
ctaaaaagctatgactggaccgctattatggctatgccttatctggaaggtgtcgcagaa
aaatcggctgaccaatggttaatacaattgaccaatcaaattaaaaacatccctcaggct
aaagacaaatctattttagaattacaggcacaaaactggcagaaaaatggtcagcatcag
gctatttcttcgcaacaactcgctcactggatgagcctattacaactgaatggagtgaaa
aactatggttattatcccgacaattttctgcataaccaacctgaaatagaccttattcgt
cctgagttttcaacagcctggtatccgaaaaatgattaa

DBGET integrated database retrieval system