KEGG   Escherichia coli K-12 MG1655: b1024Help
Entry
b1024             CDS       T00007                                 

Gene name
pgaA
Definition
(RefSeq) partially deacetylated poly-beta-1,6-N-acetyl-D-glucosamine outer membrane porin
  KO
K11935  biofilm PGA synthesis protein PgaA
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:eco00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    b1024 (pgaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_11
Motif
Other DBs
NCBI-GeneID: 945596
NCBI-ProteinID: NP_415543
Pasteur: ycdS
RegulonDB: ECK120003129
ECOCYC: G6531
ASAP: ABE-0003469
UniProt: P69434 A0A387D2X5
Structure
PDB: 

Position
complement(1089866..1092289)
Genome map
AA seq 807 aa AA seqDB search
MYSSSRKRCPKTKWALKLLTAAFLAASPAAKSAVNNAYDALIIEARKGNTQPALSWFALK
SALSNNQIADWLQIALWAGQDKQVITVYNRYRHQQLPARGYAAVAVAYRNLQQWQNSLTL
WQKALSLEPQNKDYQRGQILTLADAGHYDTALVKLKQLNSGAPDKANLLAEAYIYKLAGR
HQDELRAMTESLPENASTQQYPTEYVQALRNNQLAAAIDDANLTPDIRADIHAELVRLSF
MPTRSESERYAIADRALAQYAALEILWHDNPDRTAQYQRIQVDHLGALLTRDRYKDVISH
YQRLKKTGQIIPPWGQYWVASAYLKDHQPKKAQSIMTELFYHKETIAPDLSDEELADLFY
SHLESENYPGALTVTQHTINTSPPFLRLMGTPTSIPNDTWLQGHSFLSTVAKYSNDLPQA
EMTARELAYNAPGNQGLRIDYASVLQARGWPRAAENELKKAEVIEPRNINLEVEQAWTAL
TLQEWQQAAVLTHDVVEREPQDPGVVRLKRAVDVHNLAELRIAGSTGIDAEGPDSGKHDV
DLTTIVYSPPLKDNWRGFAGFGYADGQFSEGKGIVRDWLAGVEWRSRNIWLEAEYAERVF
NHEHKPGARLSGWYDFNDNWRIGSQLERLSHRVPLRAMKNGVTGNSAQAYVRWYQNERRK
YGVSWAFTDFSDSNQRHEVSLEGQERIWSSPYLIVDFLPSLYYEQNTEHDTPYYNPIKTF
DIVPAFEASHLLWRSYENSWEQIFSAGVGASWQKHYGTDVVTQLGYGQRISWNDVIDAGA
TLRWEKRPYDGDREHNLYVEFDMTFRF
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgtattcaagtagcagaaaaaggtgcccgaaaaccaaatgggctttgaaacttcttact
gccgcatttttagcagcgagtcccgcggcgaagagtgctgttaataacgcctatgatgca
ttgattattgaagctcgcaagggtaatactcagccagctttgtcatggtttgcactaaaa
tcagcactcagcaataaccaaattgctgactggttacagattgccttatgggccgggcaa
gataaacaggttattaccgtttacaaccgctaccgtcatcagcaattaccagcgcgtggt
tatgcagctgtcgccgtcgcttatcgtaacctgcaacaatggcaaaactcgcttacactg
tggcaaaaggcgctctctctggagccgcaaaataaggattatcaacggggacaaatttta
accctggcagatgctggtcactatgatactgcgctggttaaacttaagcagcttaactct
ggagcaccggacaaagccaatttactcgcagaagcctatatctataaactggcggggcgt
catcaggatgaattacgggcgatgacagagtcattacctgaaaatgcatctacgcaacaa
tatcccacagaatacgtgcaggcattacgtaataatcaacttgctgccgcgattgacgat
gccaatttaacgccagatattcgcgctgatattcatgccgaactggtcagactgtcgttt
atgcctacgcgcagtgaaagtgaacgttatgccattgccgatcgcgccctcgcccaatac
gctgcattagaaattctgtggcacgataacccagaccgcactgcccagtaccagcgtatt
caggttgatcatcttggcgcgttattaactcgcgatcgttataaagacgttatttctcac
tatcagcgattaaaaaagacggggcaaattattccgccctgggggcaatattgggttgca
tcggcttatctcaaagatcatcagccgaaaaaagcacagtcaataatgaccgagctcttt
tatcacaaggagaccattgccccggatttatccgatgaagaacttgcggatctcttttac
agccacctggagagtgaaaattatccgggcgcgctaactgtcacccaacataccattaat
acttcgccgcctttccttcggttaatgggcacgcctacgagcatcccgaatgatacctgg
ttacaggggcattcgtttctctcaaccgtagcaaaatatagtaatgatcttcctcaggct
gaaatgacagccagagagcttgcttataacgcaccaggaaatcagggactgcgcattgat
tacgcgagtgtgttacaagcccgcggttggcctcgtgcagcagaaaatgaattaaaaaaa
gcagaagtgatcgagccacgtaatattaatctggaggttgaacaagcctggacagcatta
acgttacaagaatggcagcaggcagctgtcttaacgcacgatgttgtcgaacgtgaaccg
caagatcccggcgttgtacgattaaaacgtgcggttgatgtacataatcttgcagagctt
cgtatcgctggctcaacaggaattgatgccgaaggcccggatagtggtaaacatgatgtc
gacttaaccaccatcgtttattcaccaccgctgaaggataactggcgcggttttgctgga
ttcggttatgccgatggacaatttagcgaaggaaaagggattgttcgcgactggcttgcg
ggtgttgagtggcggtcacgtaatatctggctcgaggcagagtacgctgaacgcgttttc
aatcatgagcataaacccggcgcgcgcctgtctggctggtatgattttaatgataactgg
cgtattggttcgcaactggaacgcctctctcaccgcgttccattacgggcaatgaaaaat
ggtgttacaggcaacagtgctcaggcttatgttcgctggtatcaaaatgagcggcgtaag
tacggtgtctcctgggctttcactgatttttccgacagtaaccagcgtcatgaagtctca
cttgagggtcaggaacgcatctggtcttcaccatatttgattgtcgatttcctacccagt
ctgtattacgaacaaaatacagaacacgataccccatactacaaccctataaaaacgttc
gatattgttccggcatttgaggcaagccatttgttatggcgaagctatgaaaatagctgg
gagcaaatattcagcgcaggtgttggtgcctcctggcaaaaacattatggcacggatgtc
gtcacccaactcggctacgggcaacgcattagttggaatgacgtgattgatgctggcgca
acgctacgctgggaaaaacgaccttatgacggtgacagagaacacaacttatacgttgaa
ttcgatatgacattcagattttaa

DBGET integrated database retrieval system