KEGG   Escherichia coli K-12 MG1655: b1033Help
Entry
b1033             CDS       T00007                                 

Gene name
ghrA
Definition
(RefSeq) glyoxylate/hydroxypyruvate reductase A
  KO
K12972  glyoxylate/hydroxypyruvatereductase [EC:1.1.1.79 1.1.1.81]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00260  Glycine, serine and threonine metabolism
eco00620  Pyruvate metabolism
eco00630  Glyoxylate and dicarboxylate metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    b1033 (ghrA)
   00630 Glyoxylate and dicarboxylate metabolism
    b1033 (ghrA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    b1033 (ghrA)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     b1033 (ghrA)
    1.1.1.81  hydroxypyruvate reductase
     b1033 (ghrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 DUF551
Motif
Other DBs
NCBI-GeneID: 946431
NCBI-ProteinID: NP_415551
RegulonDB: ECK120003135
ECOCYC: G6539
ASAP: ABE-0003503
UniProt: P75913
Position
1097886..1098824
Genome map
AA seq 312 aa AA seqDB search
MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAV
FALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQ
QNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAG
REELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAAL
DSGKVKGAMLDVFNREPLPPESPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGE
RVCGQVDRARGY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggatatcatcttttatcacccaacgttcgatacccaatggtggattgaggcactgcgc
aaagctattcctcaggcaagagtcagagcatggaaaagcggagataatgactctgctgat
tatgctttagtctggcatcctcctgttgaaatgctggcagggcgcgatcttaaagcggtg
ttcgcactcggggccggtgttgattctattttgagcaagctacaggcacaccctgaaatg
ctgaacccttctgttccactttttcgcctggaagataccggtatgggcgagcaaatgcag
gaatatgctgtcagtcaggtgctgcattggtttcgacgttttgacgattatcgcatccag
caaaatagttcgcattggcaaccgctgcctgaatatcatcgggaagattttaccatcggc
attttgggcgcaggcgtactgggcagtaaagttgctcagagtctgcaaacctggcgcttt
ccgctgcgttgctggagtcgaacccgtaaatcgtggcctggcgtgcaaagctttgccgga
cgggaagaactgtctgcatttctgagccaatgtcgggtattgattaatttgttaccgaat
acccctgaaaccgtcggcattattaatcaacaattactcgaaaaattaccggatggcgcg
tatctcctcaacctggcgcgtggtgttcatgttgtggaagatgacctgctcgcggcgctg
gatagcggcaaagttaaaggcgcaatgttggatgtttttaatcgtgaacccttaccgcct
gaaagtccgctctggcaacatccacgcgtgacgataacaccacatgtcgccgcgattacc
cgtcccgctgaagctgtggagtacatttctcgcaccattgcccagctcgaaaaaggggag
agggtctgcgggcaagtcgaccgcgcacgcggctactaa

DBGET integrated database retrieval system