KEGG   Escherichia coli K-12 MG1655: b1042
Entry
b1042             CDS       T00007                                 

Gene name
csgA
Definition
(RefSeq) curlin, major subunit
  KO
K04334  major curlin subunit
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:eco00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    b1042 (csgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eco02044]
    b1042 (csgA)
Secretion system [BR:eco02044]
 Extracellular nucleation-precipitation pathway
  Curli assembly protein
   b1042 (csgA)
SSDB
Motif
Pfam: Curlin_rpt
Other DBs
NCBI-GeneID: 949055
NCBI-ProteinID: NP_415560
Pasteur: csgA
RegulonDB: ECK120001445
ECOCYC: EG11489
ASAP: ABE-0003537
UniProt: P28307
Position
1104447..1104902
AA seq 151 aa
MKLLKVAAIAAIVFSGSALAGVVPQYGGGGNHGGGGNNSGPNSELNIYQYGGGNSALALQ
TDARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKNSEMTVKQFGG
GNGAAVDQTASNSSVNVTQVGFGNNATAHQY
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaaacttttaaaagtagcagcaattgcagcaatcgtattctccggtagcgctctggca
ggtgttgttcctcagtacggcggcggcggtaaccacggtggtggcggtaataatagcggc
ccaaattctgagctgaacatttaccagtacggtggcggtaactctgcacttgctctgcaa
actgatgcccgtaactctgacttgactattacccagcatggcggcggtaatggtgcagat
gttggtcagggctcagatgacagctcaatcgatctgacccaacgtggcttcggtaacagc
gctactcttgatcagtggaacggcaaaaattctgaaatgacggttaaacagttcggtggt
ggcaacggtgctgcagttgaccagactgcatctaactcctccgtcaacgtgactcaggtt
ggctttggtaacaacgcgaccgctcatcagtactaa

DBGET integrated database retrieval system