KEGG   Escherichia coli K-12 MG1655: b1046
Entry
b1046             CDS       T00007                                 

Gene name
clsC
Definition
(RefSeq) cardiolipin synthase C
  KO
K06132  cardiolipin synthase C [EC:2.7.8.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00564  Glycerophospholipid metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    b1046 (clsC)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     b1046 (clsC)
SSDB
Motif
Pfam: PLDc_2 PLDc
Other DBs
NCBI-GeneID: 947321
NCBI-ProteinID: NP_415564
Pasteur: ymdC
RegulonDB: ECK120003147
ECOCYC: G6551
ASAP: ABE-0003551
UniProt: P75919
Position
1106355..1107776
AA seq 473 aa
MPRLASAVLPLCSQHPGQCGLFPLEKSLDAFAARYRLAEMAEHTLDVQYYIWQDDMSGRL
LFSALLAAAKRGVRVRLLLDDNNTPGLDDILRLLDSHPRIEVRLFNPFSFRLLRPLGYIT
DFSRLNRRMHNKSFTVDGVVTLVGGRNIGDAYFGAGEEPLFSDLDVMAIGPVVEDVADDF
ARYWYCKSVSPLQQVLDVPEGEMADRIELPASWHNDAMTHRYLRKMESSPFINHLVDGTL
PLIWAKTRLLSDDPAKGEGKAKRHSLLPQRLFDIMGSPSERIDIISSYFVPTRAGVAQLL
RMVRKGVKIAILTNSLAANDVAVVHAGYARWRKKLLRYGVELYELKPTREQSSTLHDRGI
TGNSGASLHAKTFSIDGKTVFIGSFNFDPRSTLLNTEMGFVIESETLAQLIDKRFIQSQY
DAAWQLRLDRWGRINWVDRHAKKEIILKKEPATSFWKRVMVRLASILPVEWLL
NT seq 1422 nt   +upstreamnt  +downstreamnt
ttgccccggctggcgagcgcggtgctgccactgtgttcgcaacatcccggtcagtgtggc
ctttttcctctggagaaaagtctggatgcgtttgccgcccggtatcgtctggccgaaatg
gcagagcatacgctcgatgttcagtattacatctggcaggacgatatgtcgggtcggtta
ctgttttccgccctgttagccgcagcaaagcgtggcgttcgcgtccgtttgttgctggac
gacaacaatacgcccggacttgacgacattttacgcttgcttgacagtcatccacgcatt
gaagtccggctttttaatcctttctcgtttcgcttgctgcgtccgcttggttatatcacc
gacttttcccgtcttaatcgccgtatgcacaataaaagtttcactgtcgatggcgtggtg
accctggtgggaggacgaaatattggtgatgcctattttggagcaggggaggagccactt
ttttcggatttagatgtcatggcaataggacccgtggtagaggacgttgccgatgatttc
gcccgctactggtattgcaaatcggtttcacccttacagcaggtgctggatgtcccggag
ggtgaaatggcggatcgcatcgagttacccgcctcctggcataacgatgccatgacgcat
cgttatttacgcaaaatggaatccagtccatttataaatcatctggttgatggaacattg
ccgcttatctgggcgaagacacgtttattaagtgatgatccggcgaaaggggagggcaag
gcaaaacggcattcactgttaccgcagcgcctgttcgatatcatgggctcacccagtgaa
cgcatcgatattatctcttcctattttgtaccgacacgcgcaggtgtggcgcaactctta
cggatggtgagaaaaggggtaaagattgcgatcctaaccaattctcttgccgctaacgat
gttgctgtcgtccatgccggatacgcgcgctggcgcaaaaaattgctccgctatggcgtg
gaattatatgaactcaagccgacgcgtgaacaaagtagtacgttacacgatcgcggcata
accggtaattccggagccagcctgcatgctaaaacctttagcatcgatggtaaaacggtg
tttatcggctctttcaatttcgatccgcgttcaacattgctcaatactgaaatgggcttc
gtgatagagagcgaaacgctggcacagttaattgataaacgctttattcagagccagtat
gatgcggcctggcagctccgtctggacaggtggggacggatcaactgggttgatcgtcat
gcaaagaaagagattattctcaaaaaagaacccgccaccagtttctggaagcgggttatg
gtcagactggcgtcgatattgcccgtggaatggttattgtaa

DBGET integrated database retrieval system