KEGG   Escherichia coli K-12 MG1655: b1053
Entry
b1053             CDS       T00007                                 
Symbol
mdtG
Name
(RefSeq) efflux pump MdtG
  KO
K08161  MFS transporter, DHA1 family, multidrug resistance protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1053 (mdtG)
Transporters [BR:eco02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    b1053 (mdtG)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like ATG22
Other DBs
NCBI-GeneID: 945627
NCBI-ProteinID: NP_415571
Pasteur: yceE
RegulonDB: ECK120001314
ECOCYC: EG11343
ASAP: ABE-0003572
UniProt: P25744
Position
complement(1114264..1115490)
AA seq 408 aa
MSPCENDTPINWKRNLIVAWLGCFLTGAAFSLVMPFLPLYVEQLGVTGHSALNMWSGIVF
SITFLFSAIASPFWGGLADRKGRKLMLLRSALGMGIVMVLMGLAQNIWQFLILRALLGLL
GGFVPNANALIATQVPRNKSGWALGTLSTGGVSGALLGPMAGGLLADSYGLRPVFFITAS
VLILCFFVTLFCIREKFQPVSKKEMLHMREVVTSLKNPKLVLSLFVTTLIIQVATGSIAP
ILTLYVRELAGNVSNVAFISGMIASVPGVAALLSAPRLGKLGDRIGPEKILITALIFSVL
LLIPMSYVQTPLQLGILRFLLGAADGALLPAVQTLLVYNSSNQIAGRIFSYNQSFRDIGN
VTGPLMGAAISANYGFRAVFLVTAGVVLFNAVYSWNSLRRRRIPQVSN
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgtcaccctgtgaaaatgacacccctataaactggaaacgaaacctgatcgtcgcctgg
ctaggctgttttcttaccggtgccgccttcagtctggtaatgcccttcttacccctctac
gttgagcagcttggcgttaccggtcactccgccctgaatatgtggtccggtattgtcttc
agcattacatttttattttcggccatcgcctcaccgttttggggtggactcgccgaccgt
aaaggccgaaaactcatgctattacgctctgccctcggcatgggcatcgtgatggtgttg
atggggctggcacaaaatatctggcagtttttgatcctgcgggcgcttcttgggttactt
ggcggatttgtccccaacgctaatgctcttatcgccacacaagtaccgcgtaataaaagc
ggctgggcgctgggtacgctctccacaggcggcgttagtggtgcgttgctcggcccaatg
gctggcggcctgctcgccgatagctacggcttacgtccggtattctttattaccgccagt
gtgctcatactctgctttttcgtcaccctgttttgcatcagagaaaaattccagccggtc
agcaaaaaagagatgctgcacatgcgggaagtggtgacatcacttaaaaacccgaaactg
gtactcagcctgtttgtcactacgttaatcatccaggtggcgacgggctcaattgccccc
attctgacgctgtatgtccgcgaactggcgggtaacgtcagtaacgtcgcctttatcagt
ggcatgatcgcctcggtgccaggcgtggcggctctgctaagtgcaccacgactcggcaaa
cttggcgatcgaatcggacccgaaaagatcctgattacagcgctgatcttttctgtactg
ctgttgatcccaatgtcttacgttcagacgccattgcaacttgggattttacgttttttg
ctcggtgccgccgatggtgcactactccccgccgtacagacactgttggtttacaactcg
agcaaccagatcgccgggcgtatcttcagctataaccaatcgtttcgtgatattggcaac
gttaccggaccattgatgggagcagcgatttcagcgaactacggtttcagagcggtattt
ctcgtcaccgctggcgtagtgttattcaacgcagtctattcatggaacagtctacgtcgt
cgtcgaataccccaggtatcgaactga

DBGET integrated database retrieval system