KEGG   Escherichia coli K-12 MG1655: b1109
Entry
b1109             CDS       T00007                                 

Gene name
ndh
Definition
(RefSeq) NADH:quinone oxidoreductase II
  KO
K03885  NADH:ubiquinone reductase (H+-translocating) [EC:7.1.1.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    b1109 (ndh)
Enzymes [BR:eco01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     b1109 (ndh)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox DAO Pyr_redox_3 Lycopene_cycl NAD_binding_9 NAD_binding_8 HI0933_like Trp_halogenase
Other DBs
NCBI-GeneID: 946792
NCBI-ProteinID: NP_415627
Pasteur: ndh
RegulonDB: ECK120000642
ECOCYC: EG10649
ASAP: ABE-0003746
UniProt: P00393
Position
1166085..1167389
AA seq 434 aa
MTTPLKKIVIVGGGAGGLEMATQLGHKLGRKKKAKITLVDRNHSHLWKPLLHEVATGSLD
EGVDALSYLAHARNHGFQFQLGSVIDIDREAKTITIAELRDEKGELLVPERKIAYDTLVM
ALGSTSNDFNTPGVKENCIFLDNPHQARRFHQEMLNLFLKYSANLGANGKVNIAIVGGGA
TGVELSAELHNAVKQLHSYGYKGLTNEALNVTLVEAGERILPALPPRISAAAHNELTKLG
VRVLTQTMVTSADEGGLHTKDGEYIEADLMVWAAGIKAPDFLKDIGGLETNRINQLVVEP
TLQTTRDPDIYAIGDCASCPRPEGGFVPPRAQAAHQMATCAMNNILAQMNGKPLKNYQYK
DHGSLVSLSNFSTVGSLMGNLTRGSMMIEGRIARFVYISLYRMHQIALHGYFKTGLMMLV
GSINRVIRPRLKLH
NT seq 1305 nt   +upstreamnt  +downstreamnt
ttgactacgccattgaaaaagattgtgattgtcggcggcggtgctggtgggctggaaatg
gcaacacagctggggcataagctgggacgcaagaaaaaagccaaaattacgctggtcgat
cgtaaccacagccacctgtggaaaccgctgctgcacgaagtggcgactggctcgcttgat
gaaggcgtcgatgcgttgagctatctggcccatgcgcgcaatcatggtttccagttccag
ctgggttccgtcattgatattgatcgtgaagcgaaaacaatcactattgcagaactgcgc
gacgagaaaggtgaactgctggttccggaacgtaaaatcgcctatgacaccctggtaatg
gcgctgggtagcacctctaacgatttcaatacgccaggtgtcaaagagaactgcattttc
ctcgataacccgcaccaggcgcgtcgcttccaccaggagatgctgaatttgttcctgaaa
tactccgccaacctgggcgcgaatggcaaagtgaacattgcgattgtcggcggcggcgcg
acgggtgtagaactctccgctgaattgcacaacgcggtcaagcaactgcacagctacggt
tacaaaggcctgaccaacgaagccctgaacgtaacgctggtagaagcgggagaacgtatt
ttgcctgcgttaccgccacgtatctctgctgcggcccacaacgagctaacgaaacttggc
gttcgcgtgctgacgcaaaccatggtcaccagtgctgatgaaggcggcctgcacactaaa
gatggcgaatatattgaggctgatctgatggtatgggcagccgggatcaaagcgccagac
ttcctgaaagatatcggtggtcttgaaactaaccgtatcaaccagctggtggtggaaccg
acgctgcaaaccacccgcgatccagacatttacgctattggcgactgcgcgtcatgcccg
cgtccggaagggggctttgttccgccgcgtgctcaggctgcacaccagatggcgacttgc
gcaatgaacaacattctggcgcagatgaacggtaagccgctgaaaaattatcagtataaa
gatcatggttcgctggtatcgctgtcgaacttctccaccgtcggtagcctgatgggtaac
ctgacgcgcggctcaatgatgattgaaggacgaattgcgcgctttgtatatatctcgcta
taccgaatgcatcagattgcgctgcatggttactttaaaaccggattaatgatgctggtg
gggagtattaaccgcgttatccgtccgcgtttgaagttgcattaa

DBGET integrated database retrieval system