KEGG   Escherichia coli K-12 MG1655: b1117
Entry
b1117             CDS       T00007                                 

Symbol
lolD
Name
(RefSeq) lipoprotein release complex - ATP binding subunit
  KO
K09810  lipoprotein-releasing system ATP-binding protein [EC:7.6.2.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b1117 (lolD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1117 (lolD)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter
    b1117 (lolD)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_16 RsgA_GTPase SbcC_Walker_B AAA_22 AAA_30 FtsK_SpoIIIE DUF87 AAA_23 MMR_HSR1 AAA_33 NACHT
Other DBs
NCBI-GeneID: 945670
NCBI-ProteinID: NP_415635
Pasteur: ycfV
RegulonDB: ECK120003170
ECOCYC: G6574
ASAP: ABE-0003774
UniProt: P75957
Structure
Position
1176619..1177320
AA seq 233 aa
MNKILLQCDNLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLLHLLGGLDT
PTSGDVIFNGQPMSKLSSAAKAELRNQKLGFIYQFHHLLPDFTALENVAMPLLIGKKKPA
EINSRALEMLKAVGLDHRANHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDARN
ADSIFQLLGELNRLQGTAFLVVTHDLQLAKRMSRQLEMRDGRLTAELSLMGAE
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaataagatcctgttgcaatgcgacaacctgtgcaaacgctatcaggaaggcagtgtg
caaaccgatgtgctgcacaatgtcagtttcagcgtcggcgaaggtgaaatgatggcgatc
gtcggtagctctggttccggtaaaagtaccttgctgcacctgctgggcgggctggatacg
ccaacctccggcgatgtgatttttaatggtcagccaatgagcaaactgtcgtcggcagcg
aaagctgaactgcgcaaccagaagctgggctttatttatcagtttcaccacctgctgccg
gattttaccgccctggaaaacgtggctatgccgctgctgattggcaagaaaaagcccgct
gaaatcaacagccgtgcacttgagatgttaaaagcggtggggctggatcatcgtgcgaat
caccgcccatctgaactttctggcggcgaacgccagcgtgtggcgattgcccgtgcgctg
gtgaataacccgcgcctggtactggcggatgaacctaccggtaacctcgatgcgcgtaac
gccgacagcatcttccagttgcttggggaattgaatcgcttgcagggcaccgccttcctg
gtggttactcacgacctgcaactggcgaaacgtatgagccgccagttagaaatgcgtgat
ggtcgtctgacggcggaactgagcctgatgggggcggagtaa

DBGET integrated database retrieval system