KEGG   Escherichia coli K-12 MG1655: b1118
Entry
b1118             CDS       T00007                                 

Symbol
lolE
Name
(RefSeq) lipoprotein release complex - inner membrane subunit
  KO
K09808  lipoprotein-releasing system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b1118 (lolE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1118 (lolE)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter
    b1118 (lolE)
SSDB
Motif
Pfam: FtsX MacB_PCD NrfD Neurensin
Other DBs
NCBI-GeneID: 945665
NCBI-ProteinID: NP_415636
Pasteur: ycfW
RegulonDB: ECK120003171
ECOCYC: G6575
ASAP: ABE-0003776
UniProt: P75958
Structure
Position
1177320..1178564
AA seq 414 aa
MAMPLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRIL
AVVPHGEIEAVDQPWTNWQEALDHVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNP
QQEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALKVKQGDWVSIMIPNSNPEHKLM
QPKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMGSSVSGIALKMTDVFNANKLVRD
AGEVTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMVLVIGVACFNIVSTLVMAVKDKSG
DIAVLRTLGAKDGLIRAIFVWYGLLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQF
LSSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASWYPARRASNIDPARVLSGQ
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggcgatgcctttatcgttattaattggcctgcgttttagtcgcggacggcggcgcggc
ggcatggtgtcgctgatctccgttatttctaccattggcattgccctcggcgtggcggta
ttgatcgtcggcttaagcgcgatgaacggctttgaacgcgaactgaacaaccgtattctg
gcggtggtgccgcatggtgaaatcgaggcggtggatcagccgtggactaactggcaggaa
gcactggatcacgtgcaaaaagtgccgggtattgccgctgccgcgccgtatatcaatttc
accgggctggtggaaagtggcgcgaatcttcgcgcaatccaggtgaagggcgttaacccg
caacaggaacagcgtctgagcgcattaccctcgtttgtccagggcgatgcgtggcgcaat
tttaaagcgggcgaacagcaaattatcatcggcaaaggcgtggcggatgcgctgaaagtg
aagcagggggattgggtgtcgattatgatccccaactcgaatcccgagcataaactgatg
cagccaaaacgtgtgcgtttgcacgttgccggtattttgcagttgagtggtcaactcgat
cacagttttgccatgatcccgctggcggatgcccaacaatatcttgatatgggttccagc
gtgtcaggtattgcccttaaaatgacggatgttttcaacgccaataagctggtacgcgat
gcgggtgaagtgaccaacagctatgtttatattaaaagctggattggtacttacggctat
atgtatcgcgatatccaaatgatccgcgccattatgtatctggcgatggtactggtgatt
ggcgtggcctgtttcaacatcgtctccaccttagtgatggcggtgaaagacaagagtggc
gatatcgcagtattaagaacgctgggggcgaaagatggtttaattcgcgccatctttgtc
tggtatggattgctggcagggctgttcggcagcctgtgtggtgtgattatcggcgtagtg
gtttcactgcaacttaccccgattattgagtggattgaaaagttgatcggtcatcagttc
ctctccagcgatatctattttattgatttcctgccatcggaattgcactggctggacgtc
ttctacgtactggtcacagcattgttgctgagtcttttggcaagttggtatccggcgcgg
cgcgccagtaatattgaccctgcgcgagtccttagcggccagtaa

DBGET integrated database retrieval system