KEGG   Escherichia coli K-12 MG1655: b1122
Entry
b1122             CDS       T00007                                 
Symbol
ymfA
Name
(RefSeq) putative inner membrane protein YmfA
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: DUF3592
Other DBs
NCBI-GeneID: 945684
NCBI-ProteinID: NP_415640
Pasteur: ymfA
RegulonDB: ECK120003175
ECOCYC: G6579
ASAP: ABE-0003786
UniProt: P75962
Position
complement(1181264..1181725)
AA seq 153 aa
MSQDSKVFFRIFLGIGLVLILISVVVFYNQFTYSKDAIHTEGVIVDTVWHSSHSHRTGKD
GSWYPVVAFRPTPDYTLIFNSSIGSDFYEDSEGDKVNVYYSPGHPEKAEINNPWVNFFKW
GFIGIMGVIFIAVGLLISMPSSKKSRRKRKSRP
NT seq 462 nt   +upstreamnt  +downstreamnt
atgagtcaggacagtaaagttttctttcgtatattcctcggtatcggtctggtactgatc
ctcatttctgttgttgtcttttataaccagttcacctatagcaaagacgcgattcatacc
gaaggcgtcattgttgataccgtctggcactccagtcattctcatcgcacgggtaaagat
ggttcgtggtatcccgtcgttgcctttcgaccgacgccagattacacgctaattttcaat
tcgagtatcggcagcgatttttatgaagacagcgaaggcgataaagttaatgtttattat
tctcccgggcatcctgaaaaggctgagataaataacccgtgggttaatttttttaaatgg
gggtttatcggcattatgggcgttatttttatcgccgtcggtttattaataagtatgccc
tcctctaaaaaatcacgcaggaaacggaagtcccgcccatga

DBGET integrated database retrieval system