KEGG   Escherichia coli K-12 MG1655: b1124Help
Entry
b1124             CDS       T00007                                 

Gene name
potC
Definition
(RefSeq) spermidine preferential ABC transporter membrane subunit PotC
  KO
K11070  spermidine/putrescine transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00299  Spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b1124 (potC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1124 (potC)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Spermidine/putrescine transporter [MD:M00299] [OT]
    b1124 (potC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF3341
Motif
Other DBs
NCBI-GeneID: 945691
NCBI-ProteinID: NP_415642
Pasteur: potC
RegulonDB: ECK120000742
ECOCYC: EG10751
ASAP: ABE-0003791
UniProt: P0AFK6
Position
complement(1182826..1183620)
Genome map
AA seq 264 aa AA seqDB search
MIGRLLRGGFMTAIYAYLYIPIIILIVNSFNSSRFGINWQGFTTKWYSLLMNNDSLLQAA
QHSLTMAVFSATFATLIGSLTAVALYRYRFRGKPFVSGMLFVVMMSPDIVMAISLLVLFM
LLGIQLGFWSLLFSHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPL
AMPAVAAGWVLSFTLSMDDVVVSSFVTGPSYEILPLKIYSMVKVGVSPEVNALATILLVL
SLVMVIASQLIARDKTKGNTGDVK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgactgcttcgcggcggttttatgaccgctatctacgcgtacctgtatatc
ccaatcattattttgattgtgaactcctttaacagctcgcgctttggcatcaactggcag
ggctttaccaccaaatggtatagcctgctgatgaacaacgacagcctgttacaggcagcg
cagcattcactaacaatggcggtgttttcggcgacgtttgctacgcttatcggttcactg
acggcagttgcgctgtaccgttatcgctttcgtggtaagccgttcgttagcggaatgctg
tttgtggtgatgatgtcaccagatatcgtgatggcgatttcgctgctggtgctgtttatg
ctgctgggtattcagcttggcttctggtcgctgctgttctcgcatatcaccttctgcctg
ccatttgtggtggtgacggtgtattcgcgcctgaaaggttttgacgtgcgaatgctggaa
gcggcgaaagatctcggtgccagcgaatttaccattctgcgaaaaatcattctgccactg
gcaatgccagcggtggcggcgggctgggtgttaagctttaccctgtcgatggacgatgtg
gtagtttcttcgttcgtcaccggaccaagttatgaaattctgccgttaaaaatttattcg
atggtcaaagtcggcgtatcgccggaagttaacgcgctggcaaccatattactggtgctg
tcgctggtgatggttattgccagccagcttattgctcgtgataaaacgaaaggtaacaca
ggggacgttaaatga

DBGET integrated database retrieval system