KEGG   Escherichia coli K-12 MG1655: b1134Help
Entry
b1134             CDS       T00007                                 

Gene name
nudJ
Definition
(RefSeq) bifunctional thiamine pyrimidine pyrophosphate hydrolase and thiamine pyrophosphate hydrolase
  KO
K12152  phosphatase NudJ [EC:3.6.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     b1134 (nudJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-GeneID: 945689
NCBI-ProteinID: NP_415652
Pasteur: ymfB
RegulonDB: ECK120003176
ECOCYC: G6580
ASAP: ABE-0003818
UniProt: P0AEI6
Structure
PDB: 

Position
complement(1193827..1194288)
Genome map
AA seq 153 aa AA seqDB search
MFKPHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAARELWEETGISA
QPQHFIRMHQWIAPDKTPFLRFLFAIELEQICPTQPHDSDIDCCRWVSAEEILQASNLRS
PLVAESIRCYQSGQRYPLEMIGDFNWPFTKGVI
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaccgcacgttaccgttgcttgcgtggtgcacgcagaaggcaaatttttagtc
gttgaagagacgattaatggtaaagcgttatggaaccaacctgccgggcatctggaagcc
gatgaaaccttagtggaagccgccgcccgtgaactgtgggaagaaaccggcatcagcgcg
cagccgcaacactttattcgtatgcatcagtggattgcgccagataaaacgccgtttttg
cgtttcctctttgccattgagcttgagcaaatatgcccgacccagcctcatgacagcgat
atcgactgctgccgttgggtcagcgccgaagaaattttacaggcgtcaaatcttcgttcg
ccgctggtggcggaaagtattcgttgttatcaaagcgggcaacgttatccgctggagatg
attggcgattttaactggccttttacaaagggtgtcatctaa

DBGET integrated database retrieval system