KEGG   Escherichia coli K-12 MG1655: b1188Help
Entry
b1188             CDS       T00007                                 

Gene name
ycgB
Definition
(RefSeq) SpoVR family stationary phase protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoVR P21-Arc
Motif
Other DBs
NCBI-GeneID: 946365
NCBI-ProteinID: NP_415706
Pasteur: ycgB
RegulonDB: ECK120001471
ECOCYC: EG11516
ASAP: ABE-0003990
UniProt: P29013
Position
complement(1235709..1237241)
Genome map
AA seq 510 aa AA seqDB search
MATIDSMNKDTTRLSDGPDWTFDLLDVYLAEIDRVAKLYRLDTYPHQIEVITSEQMMDAY
SSVGMPINYPHWSFGKKFIETERLYKHGQQGLAYEIVINSNPCIAYLMEENTITMQALVM
AHACYGHNSFFKNNYLFRSWTDASSIVDYLIFARKYITECEERYGVDEVERLLDSCHALM
NYGVDRYKRPQKISLQEEKARQKSREEYLQSQVNMLWRTLPKREEEKTVAEARRYPSEPQ
ENLLYFMEKNAPLLESWQREILRIVRKVSQYFYPQKQTQVMNEGWATFWHYTILNHLYDE
GKVTERFMLEFLHSHTNVVFQPPYNSPWYSGINPYALGFAMFQDIKRICQSPTEEDKYWF
PDIAGSDWLETLHFAMRDFKDESFISQFLSPKVMRDFRFFTVLDDDRHNYLEISAIHNEE
GYREIRNRLSSQYNLSNLEPNIQIWNVDLRGDRSLTLRYIPHNRAPLDRGRKEVLKHVHR
LWGFDVMLEQQNEDGSIELLERCPPRMGNL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgatcgattctatgaataaggacaccacacgtttgagcgatggacccgactgg
acgttcgacctgctggatgtttatctggcagagatagaccgggtggcgaaactctaccgg
ctggatacctacccgcaccagattgaagtgataacctcagaacagatgatggatgcctac
tccagcgtcggcatgccaattaactatccgcactggtcattcggtaaaaagtttatcgag
actgaacggctgtataagcacggtcagcaaggactggcctatgaaatcgtcattaactct
aacccgtgtatcgcttacctgatggaagagaacaccattaccatgcaagcgctggtgatg
gctcatgcctgctatgggcataactctttcttcaaaaacaattacttattccgtagctgg
accgacgccagttcgattgtcgattatctgatttttgcccgtaaatatattaccgagtgc
gaagagcgttatggcgttgatgaagtagaacggcttctggactcgtgccacgcgctgatg
aactacggcgtggaccggtacaaacgcccgcaaaaaatctcgctgcaagaagagaaagcc
cggcagaaaagtcgcgaagagtatctgcaaagtcaggtcaatatgctctggcgtaccctg
ccgaagcgcgaggaagagaaaacggttgctgaagcgcgccgctatccgtccgaaccacaa
gaaaacctgctctattttatggagaaaaatgcgccactgctggaatcatggcagcgtgaa
atcctgcgtattgtgcgtaaggtgagccagtatttttatccgcaaaaacagactcaggtg
atgaacgaaggctgggcgaccttctggcactacaccatccttaaccatctgtatgatgaa
gggaaagtaacggaacgttttatgctggagtttttgcacagccacaccaatgtggtcttc
cagcccccctataacagcccgtggtacagcggcatcaacccgtatgccctcgggttcgcc
atgttccaggatattaaacggatttgtcagtcgccaacggaagaagacaaatactggttc
ccggatatcgccggttccgactggctggaaacgctgcatttcgcgatgcgtgatttcaaa
gatgagagttttatcagccagttcctgtcaccgaaagtgatgcgtgatttccgcttcttc
accgtgctggatgacgatcggcataattatctggagatttccgctattcataatgaagaa
ggttatcgggagatccgtaaccggttatcgtcgcaatataacttaagtaatctggagccg
aatattcagatctggaacgtggatttgcgcggcgaccgttcgctgacgctgcgttatatt
ccacataatcgcgcaccgctggatcgggggcgcaaagaagtcctgaagcatgtgcatcgc
ctgtggggatttgatgtgatgctcgaacagcaaaacgaagacggcagcatcgagttgctg
gaacgttgcccgccaagaatgggaaatctgtaa

DBGET integrated database retrieval system