KEGG   Escherichia coli K-12 MG1655: b1224
Entry
b1224             CDS       T00007                                 

Gene name
narG
Definition
(RefSeq) nitrate reductase A subunit alpha
  KO
K00370  nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00910  Nitrogen metabolism
eco01100  Metabolic pathways
eco01120  Microbial metabolism in diverse environments
eco02020  Two-component system
Module
eco_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    b1224 (narG)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    b1224 (narG)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     b1224 (narG)
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     b1224 (narG)
SSDB
Motif
Pfam: Molybdopterin Molydop_binding Nitr_red_alph_N Molybdop_Fe4S4
Other DBs
NCBI-GeneID: 945782
NCBI-ProteinID: NP_415742
Pasteur: narG
RegulonDB: ECK120000631
ECOCYC: EG10638
ASAP: ABE-0004119
UniProt: P09152
Structure
PDB: 

Position
1279864..1283607
AA seq 1247 aa
MSKFLDRFRYFKQKGETFADGHGQLLNTNRDWEDGYRQRWQHDKIVRSTHGVNCTGSCSW
KIYVKNGLVTWETQQTDYPRTRPDLPNHEPRGCPRGASYSWYLYSANRLKYPMMRKRLMK
MWREAKALHSDPVEAWASIIEDADKAKSFKQARGRGGFVRSSWQEVNELIAASNVYTIKN
YGPDRVAGFSPIPAMSMVSYASGARYLSLIGGTCLSFYDWYCDLPPASPQTWGEQTDVPE
SADWYNSSYIIAWGSNVPQTRTPDAHFFTEVRYKGTKTVAVTPDYAEIAKLCDLWLAPKQ
GTDAAMALAMGHVMLREFHLDNPSQYFTDYVRRYTDMPMLVMLEERDGYYAAGRMLRAAD
LVDALGQENNPEWKTVAFNTNGEMVAPNGSIGFRWGEKGKWNLEQRDGKTGEETELQLSL
LGSQDEIAEVGFPYFGGDGTEHFNKVELENVLLHKLPVKRLQLADGSTALVTTVYDLTLA
NYGLERGLNDVNCATSYDDVKAYTPAWAEQITGVSRSQIIRIAREFADNADKTHGRSMII
VGAGLNHWYHLDMNYRGLINMLIFCGCVGQSGGGWAHYVGQEKLRPQTGWQPLAFALDWQ
RPARHMNSTSYFYNHSSQWRYETVTAEELLSPMADKSRYTGHLIDFNVRAERMGWLPSAP
QLGTNPLTIAGEAEKAGMNPVDYTVKSLKEGSIRFAAEQPENGKNHPRNLFIWRSNLLGS
SGKGHEFMLKYLLGTEHGIQGKDLGQQGGVKPEEVDWQDNGLEGKLDLVVTLDFRLSSTC
LYSDIILPTATWYEKDDMNTSDMHPFIHPLSAAVDPAWEAKSDWEIYKAIAKKFSEVCVG
HLGKETDIVTLPIQHDSAAELAQPLDVKDWKKGECDLIPGKTAPHIMVVERDYPATYERF
TSIGPLMEKIGNGGKGIAWNTQSEMDLLRKLNYTKAEGPAKGQPMLNTAIDAAEMILTLA
PETNGQVAVKAWAALSEFTGRDHTHLALNKEDEKIRFRDIQAQPRKIISSPTWSGLEDEH
VSYNAGYTNVHELIPWRTLSGRQQLYQDHQWMRDFGESLLVYRPPIDTRSVKEVIGQKSN
GNQEKALNFLTPHQKWGIHSTYSDNLLMLTLGRGGPVVWLSEADAKDLGIADNDWIEVFN
SNGALTARAVVSQRVPAGMTMMYHAQERIVNLPGSEITQQRGGIHNSVTRITPKPTHMIG
GYAHLAYGFNYYGTVGSNRDEFVVVRKMKNIDWLDGEGNDQVQESVK
NT seq 3744 nt   +upstreamnt  +downstreamnt
atgagtaaattcctggaccggtttcgctacttcaaacagaagggtgaaacctttgccgat
gggcatggccagcttctcaataccaaccgtgactgggaggatggatatcgccagcgttgg
cagcatgacaaaatcgtccgctctacccacggggtaaactgcaccggctcctgcagctgg
aaaatctacgtcaaaaacggtctggtcacctgggaaacccagcagactgactatccgcgt
acccgtccggatctgccaaaccatgaacctcgcggctgcccgcgcggtgccagctactcc
tggtatctttacagtgccaaccgcctgaaatacccgatgatgcgcaaacgcctgatgaaa
atgtggcgtgaagcgaaggcgctgcatagcgatccggttgaggcatgggcttctatcatt
gaagacgccgataaagcgaaaagctttaagcaggcgcgtggacgcggtggatttgttcgt
tcttcctggcaggaggtgaacgaactgatcgccgcatctaacgtttacaccatcaaaaac
tacggcccggaccgtgttgctggtttctcgccaattccggcaatgtcgatggtttcttac
gcatcgggtgcacgctatctctcgctgattggcggtacttgcttaagcttctacgactgg
tactgcgacttgcctcctgcgtctccgcaaacctggggcgagcaaactgacgtaccggaa
tctgctgactggtacaactccagctacatcatcgcctgggggtcaaacgtgccgcagacg
cgtaccccggatgctcacttctttactgaagtgcgttacaaagggaccaaaactgttgcc
gtcacaccagactacgctgaaatcgccaaactgtgcgatctgtggctggcaccgaaacag
ggcaccgatgcggcaatggcgctggcgatgggccacgtaatgctgcgtgaattccacctc
gacaacccaagccagtatttcaccgactatgtgcgtcgctacaccgacatgccgatgctg
gtgatgctggaagaacgcgacggttactacgctgcaggtcgtatgctgcgcgctgctgat
ctggttgatgcgctgggccaggaaaacaatccggaatggaaaactgtcgcctttaatacc
aatggcgaaatggttgcgccgaacggttctattggcttccgctggggcgagaagggcaaa
tggaatcttgagcagcgcgacggcaaaactggcgaagaaaccgagctgcaactgagcctg
ctgggtagccaggatgagatcgctgaggtaggcttcccgtactttggtggcgacggcacg
gaacacttcaacaaagtggaactggaaaacgtgctgctgcacaaactgccggtgaaacgc
ctgcaactggctgatggcagcaccgccctggtgaccaccgtttatgatctgacgctggca
aactacggtctggaacgtggcctgaacgacgttaactgtgcaaccagctatgacgatgtg
aaagcttataccccggcctgggccgagcagattaccggcgtttctcgcagccagattatt
cgcatcgcccgtgaatttgccgataacgctgataaaacgcacggtcgttcgatgattatc
gtcggtgcggggctgaaccactggtatcacctcgatatgaactatcgtggtctgatcaac
atgctgattttctgcggctgtgtcggtcagagcgggggcggctgggcgcactatgtaggt
caggaaaaactgcgtccgcaaaccggctggcagccgctggcgtttgcccttgactggcag
cgtccggcgcgtcacatgaacagcacttcttatttctataaccactccagccagtggcgt
tatgaaaccgtcacggcggaagagttgctgtcaccgatggcggacaaatcccgctatacc
ggacacttgatcgactttaacgtccgtgcggaacgcatgggctggctgccgtctgcaccg
cagttaggcactaacccgctgactatcgctggcgaagcggaaaaagccgggatgaatccg
gtggactatacggtgaaatccctgaaagagggttccatccgttttgcggcagaacaacca
gaaaacggtaaaaaccacccgcgcaacctgttcatctggcgttctaacctgctcggttct
tccggtaaaggtcatgagtttatgctcaagtacctgctggggacggagcacggtatccag
ggtaaagatctggggcaacagggcggcgtgaagccggaagaagtggactggcaggacaat
ggtctggaaggcaagctggatctggtggttacgctggacttccgtctgtcgagcacctgt
ctctattccgacatcattttgccgacggcgacctggtacgaaaaagacgacatgaatact
tcggatatgcatccgtttattcacccgctgtctgcggcggtcgatccggcctgggaagcg
aaaagcgactgggaaatctacaaagccatcgcgaagaaattctccgaagtgtgcgtcggc
catctgggtaaagaaaccgacatcgtcacgctgcctatccagcatgactctgccgctgaa
ctggcgcagccgctggatgtgaaagactggaaaaaaggcgagtgcgacctgatcccaggt
aaaaccgcgccacacattatggtcgtagagcgcgattatccggcgacttacgaacgcttt
acctctatcggcccgctgatggagaaaatcggtaatggcggtaaagggattgcctggaac
acccagagcgagatggatctgctgcgtaagctcaactacaccaaagcggaaggtccggcg
aaaggccagccgatgctgaacaccgcaattgatgcggcagagatgatcctgacactggca
ccggaaaccaacggtcaggtagccgtgaaagcctgggctgccctgagcgaatttaccggt
cgtgaccatacgcatctggcgctgaataaagaagacgagaagatccgcttccgcgatatt
caggcacagccgcgcaaaattatctccagcccgacctggtctggtctggaagatgaacac
gtttcttacaacgccggttacaccaacgttcacgagctgatcccatggcgtacgctctct
ggtcgtcagcaactgtatcaggatcaccagtggatgcgtgatttcggtgaaagcctgctg
gtttatcgtccgccgatcgacacccgttcggtgaaagaagtgataggccagaaatccaac
ggcaaccaggaaaaagcgctcaacttcctgacgccgcaccagaagtggggtatccactcc
acctacagcgacaacctgctgatgctgactttaggtcgcggtggtccggtggtctggttg
agtgaagccgatgccaaagatctgggtatcgccgataacgactggattgaagtcttcaac
agcaacggtgctctgactgcccgtgcggttgtcagccagcgtgttccggcagggatgacc
atgatgtaccacgcgcaggaacgtatcgttaacctgcctggttcggaaattacccaacag
cgtggtggtatccataactcggtcacccgtatcacgccgaaaccgacgcatatgatcggc
ggctatgcccatctggcatacggctttaactactatggcaccgtaggttctaaccgcgat
gagtttgttgtagtgcgtaagatgaagaacattgactggttagatggcgaaggcaatgac
caggtacaggagagcgtaaaatga

DBGET integrated database retrieval system