KEGG   Escherichia coli K-12 MG1655: b1227Help
Entry
b1227             CDS       T00007                                 

Gene name
narI
Definition
(RefSeq) nitrate reductase A subunit gamma
  KO
K00374  nitrate reductase gamma subunit [EC:1.7.5.1 1.7.99.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00910  Nitrogen metabolism
eco01120  Microbial metabolism in diverse environments
eco02020  Two-component system
Module
eco_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    b1227 (narI)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    b1227 (narI)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     b1227 (narI)
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     b1227 (narI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitrate_red_gam DUF2407_C
Motif
Other DBs
NCBI-GeneID: 945808
NCBI-ProteinID: NP_415745
Pasteur: narI
RegulonDB: ECK120000633
ECOCYC: EG10640
ASAP: ABE-0004125
UniProt: P11350
Structure
PDB: 

Position
1285849..1286526
Genome map
AA seq 225 aa AA seqDB search
MQFLNMFFFDIYPYIAGAVFLIGSWLRYDYGQYTWRAASSQMLDRKGMNLASNLFHIGIL
GIFVGHFFGMLTPHWMYEAWLPIEVKQKMAMFAGGASGVLCLIGGVLLLKRRLFSPRVRA
TTTGADILILSLLVIQCALGLLTIPFSAQHMDGSEMMKLVGWAQSVVTFHGGASQHLDGV
AFIFRLHLVLGMTLFLLFPFSRLIHIWSVPVEYLTRKYQLVRARH
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcctgaatatgttcttctttgatatctacccgtacatagccggggcggtcttc
ctgattggtagctggctgcgttatgactacgggcagtacacctggcgcgcggcgtccagc
cagatgctggatcgcaaagggatgaacctggcgtcgaacctgttccatatcgggattctg
gggatttttgtcggtcacttcttcggtatgctgacgccgcactggatgtatgaagcctgg
ctgccgattgaagtgaaacagaaaatggcaatgtttgctggtggtgccagcggcgtgctg
tgtctgattggcggcgtgctgttgctgaaacgtcgtctgttcagcccacgcgtgcgtgca
accactaccggagcggatatcctgatcctgtcgctgctcgttatccagtgcgcgctgggc
ctgttgaccattccgttctccgctcagcatatggacggtagcgagatgatgaaactggtt
ggctgggcgcagtcggtggtgaccttccacggtggcgcttctcaacacctcgatggtgtg
gcgtttatcttccgtctgcacctggtgctggggatgacgttattcctgctgttcccgttc
tcgcgtctgatacacatctggagcgtaccggtggagtatctgacacgtaagtaccagctg
gtgcgcgctcgtcactaa

DBGET integrated database retrieval system