KEGG   Escherichia coli K-12 MG1655: b1245Help
Entry
b1245             CDS       T00007                                 

Gene name
oppC
Definition
(RefSeq) murein tripeptide ABC transporter/oligopeptide ABC transporter inner membrane subunit OppC
  KO
K15582  oligopeptide transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco01501  beta-Lactam resistance
eco02010  ABC transporters
eco02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b1245 (oppC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    b1245 (oppC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    b1245 (oppC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1245 (oppC)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    b1245 (oppC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N DUF3176
Motif
Other DBs
NCBI-GeneID: 945810
NCBI-ProteinID: NP_415761
Pasteur: oppC
RegulonDB: ECK120000669
ECOCYC: EG10676
ASAP: ABE-0004176
UniProt: P0AFH6
Position
1303834..1304742
Genome map
AA seq 302 aa AA seqDB search
MMLSKKNSETLENFSEKLEVEGRSLWQDARRRFMHNRAAVASLIVLVLIALFVILAPMLS
QFAYDDTDWAMMSSAPDMESGHYFGTDSSGRDLLVRVAIGGRISLMVGVAAALVAVVVGT
LYGSLSGYLGGKVDSVMMRLLEILNSFPFMFFVILLVTFFGQNILLIFVAIGMVSWLDMA
RIVRGQTLSLKRKEFIEAAQVGGVSTSGIVIRHIVPNVLGVVVVYASLLVPSMILFESFL
SFLGLGTQEPLSSWGALLSDGANSMEVSPWLLLFPAGFLVVTLFCFNFIGDGLRDALDPK
DR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatgttaagtaagaaaaacagcgagacgctggaaaatttcagtgaaaagctggaggtc
gaagggcgcagcttgtggcaggacgcacgtcgacgttttatgcataaccgtgcggcggtt
gccagtctgatagtgctggtgctgatcgcgttatttgtaatcctggcaccgatgctttcc
cagtttgcctatgacgatactgactgggcgatgatgtccagcgccccggatatggagtcc
ggtcactactttggtactgactcatccggtcgcgacctgcttgtgcgcgttgcgattggc
gggcgtatctcactcatggtcggtgttgctgcggcactggtggctgtggtcgtcgggaca
ctttatggttcgctttccggttatctgggcggtaaagtggattcggtaatgatgcgtctg
ctggaaatcctcaactccttcccattcatgttcttcgtcattttgctggtgacctttttc
ggtcaaaacatcctgctgattttcgtggcgataggcatggtttcctggctggatatggct
cgtattgtgcgtgggcaaaccctgagtctgaagcgcaaagagtttattgaggcggcacaa
gttggcggtgtatcgacatcgggcattgttattcgccacattgtgccgaatgtactcggt
gtggtggtggtctacgcatcacttctggtgcccagcatgatcctctttgaatctttcctt
agcttcctggggttgggtacgcaagagccgttaagcagctggggtgcattgctgagtgat
ggcgcgaactcgatggaagtctctccatggttattgttgttcccagcgggattcctcgtg
gtgacgctgttttgtttcaactttatcggcgatggcttgcgtgatgccctcgacccgaaa
gatcgttaa

DBGET integrated database retrieval system