KEGG   Escherichia coli K-12 MG1655: b1281Help
Entry
b1281             CDS       T00007                                 

Gene name
pyrF
Definition
(RefSeq) orotidine-5'-phosphate decarboxylase
  KO
K01591  orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00240  Pyrimidine metabolism
eco01100  Metabolic pathways
Module
eco_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    b1281 (pyrF)
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     b1281 (pyrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase
Motif
Other DBs
NCBI-GeneID: 947121
NCBI-ProteinID: NP_415797
Pasteur: pyrF
RegulonDB: ECK120000800
ECOCYC: EG10809
ASAP: ABE-0004304
UniProt: P08244
Structure
PDB: 

Position
1341921..1342658
Genome map
AA seq 245 aa AA seqDB search
MTLTASSSSRAVTNSPVVVALDYHNRDDALAFVDKIDPRDCRLKVGKEMFTLFGPQFVRE
LQQRGFDIFLDLKFHDIPNTAAHAVAAAADLGVWMVNVHASGGARMMTAAREALVPFGKD
APLLIAVTVLTSMEASDLVDLGMTLSPADYAERLAALTQKCGLDGVVCSAQEAVRFKQVF
GQEFKLVTPGIRPQGSEAGDQRRIMTPEQALSAGVDYMVIGRPVTQSVDPAQTLKAINAS
LQRSA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaactgcttcatcttcttcccgcgctgttacgaattctcctgtggttgttgcc
cttgattatcataatcgtgatgacgcgctggcctttgtcgacaagatcgacccacgcgat
tgtcgtctgaaggtcggcaaagagatgtttacattgtttgggccacagtttgtgcgcgaa
cttcaacagcgtggttttgatatctttcttgacctgaaattccacgatatccccaacact
gcagcgcacgctgtcgctgctgcagctgacttaggcgtgtggatggtgaatgttcatgcc
tctggtggggcgcgtatgatgaccgcagcgcgtgaggcactggttccgtttggcaaagat
gcaccgcttttgattgctgtgacagtgttgaccagcatggaagccagcgacctggtcgat
cttggcatgacactgtcacctgcagattatgcagaacgtctggcggcactgacgcaaaaa
tgtggccttgatggtgtggtgtgttctgctcaggaagctgtgcgctttaaacaggtattc
ggtcaggagttcaaactggttacgccgggcattcgtccgcaggggagtgaagctggtgac
cagcgccgcattatgacgccagaacaggcgttgtcggctggtgttgattatatggtgatt
ggtcgcccggtaacgcaatcggtagatccagcgcagacgctgaaagcgatcaacgcctct
ttacagcggagtgcatga

DBGET integrated database retrieval system