KEGG   Escherichia coli K-12 MG1655: b1292
Entry
b1292             CDS       T00007                                 

Gene name
sapC
Definition
(RefSeq) putrescine ABC exporter membrane protein SapC
  KO
K19228  cationic peptide transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco01503  Cationic antimicrobial peptide (CAMP) resistance
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b1292 (sapC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    b1292 (sapC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1292 (sapC)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Cationic peptide transporter
    b1292 (sapC)
SSDB
Motif
Pfam: BPD_transp_1 OppC_N Chal_sti_synt_N
Other DBs
NCBI-GeneID: 945266
NCBI-ProteinID: NP_415808
Pasteur: sapC
RegulonDB: ECK120002674
ECOCYC: G2000
ASAP: ABE-0004348
UniProt: P0AGH5
Position
complement(1353628..1354518)
AA seq 296 aa
MPYDSVYSEKRPPGTLRTAWRKFYSDASAMVGLYGCAGLAVLCIFGGWFAPYGIDQQFLG
YQLLPPSWSRYGEVSFFLGTDDLGRDVLSRLLSGAAPTVGGAFVVTLAATICGLVLGTFA
GATHGLRSAVLNHILDTLLAIPSLLLAIIVVAFAGPSLSHAMFAVWLALLPRMVRSIYSM
VHDELEKEYVIAARLDGASTLNILWFAVMPNITAGLVTEITRALSMAILDIAALGFLDLG
AQLPSPEWGAMLGDALELIYVAPWTVMLPGAAIMISVLLVNLLGDGVRRAIIAGVE
NT seq 891 nt   +upstreamnt  +downstreamnt
atgccttacgatagcgtatacagcgaaaagcgcccgccgggcacgctgcgtaccgcctgg
cgcaaattttatagtgacgcctctgcgatggtcggcctgtacggctgcgcggggctggct
gtactgtgtatttttggcggctggtttgcgccttacggcatcgaccagcaatttctcggt
tatcaattattgccgccgtcatggtcgcgctatggcgaagtttctttcttcctggggact
gacgacctcggacgcgatgttttaagccgtttactgagcggagctgcgccaaccgtgggt
ggcgcatttgtggtgacgcttgccgcgacgatctgtggcctggtactgggcaccttcgcc
ggggcgacacacggcctccgctcagcggtgcttaaccatattctggataccttactggcg
atcccttcgctgctgttggcaattatcgttgtagcgtttgccggaccgagtttgtcccac
gctatgtttgctgtctggctggcattgctgccgcgtatggtacgttcgatttacagcatg
gtgcatgacgaactggaaaaagagtacgttatcgccgcccgtctggatggcgcatcaacg
ctgaatattctctggtttgctgtgatgccaaacatcaccgccgggctggtcaccgagatc
acccgcgcactgtcgatggcaattctcgatatcgccgcgctgggctttctcgatctcggc
gcacaactcccctcgcctgaatggggagcgatgctcggtgatgcgctggaactgatttat
gtcgccccgtggactgtcatgctgccaggtgcggcaattatgattagcgtgttgttggtt
aacctccttggcgatggcgttcgtcgtgcgattattgcgggggtggaataa

DBGET integrated database retrieval system