KEGG   Escherichia coli K-12 MG1655: b1296
Entry
b1296             CDS       T00007                                 
Symbol
puuP
Name
(RefSeq) putrescine:H(+) symporter PuuP
  KO
K14052  putrescine importer
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1296 (puuP)
Transporters [BR:eco02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   b1296 (puuP)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 946287
NCBI-ProteinID: NP_415812
Pasteur: ycjJ
RegulonDB: ECK120003238
ECOCYC: G6643
ASAP: ABE-0004362
UniProt: P76037
Position
complement(1357802..1359187)
AA seq 461 aa
MAINSPLNIAAQPGKTRLRKSLKLWQVVMMGLAYLTPMTVFDTFGIVSGISDGHVPASYL
LALAGVLFTAISYGKLVRQFPEAGSAYTYAQKSINPHVGFMVGWSSLLDYLFLPMINVLL
AKIYLSALFPEVPPWVWVVTFVAILTAANLKSVNLVANFNTLFVLVQISIMVVFIFLVVQ
GLHKGEGVGTVWSLQPFISENAHLIPIITGATIVCFSFLGFDAVTTLSEETPDAARVIPK
AIFLTAVYGGVIFIAASFFMQLFFPDISRFKDPDAALPEIALYVGGKLFQSIFLCTTFVN
TLASGLASHASVSRLLYVMGRDNVFPERVFGYVHPKWRTPALNVIMVGIVALSALFFDLV
TATALINFGALVAFTFVNLSVFNHFWRRKGMNKSWKDHFHYLLMPLVGALTVGVLWVNLE
STSLTLGLVWASLGGAYLWYLIRRYRKVPLYDGDRTPVSET
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggctattaattcaccactgaatattgctgcgcaacccggcaaaacccgtctgcgaaaa
tcactgaaattgtggcaggtggtgatgatgggtctggcctatctcacgccgatgaccgta
tttgatacttttggtattgtctccggcattagcgacggtcacgttccggcgtcctatttg
ctggcgctggcgggtgtgctgtttaccgctatcagctacggcaaactggttcgccagttt
ccggaggccggttcggcctatacctacgcgcaaaagtcgattaacccgcacgtcggattt
atggtcggctggtcatcgctgctggattatctctttttgccgatgattaacgtcttgttg
gcgaaaatctatctctccgccctcttcccggaagtgccgccgtgggtgtgggtggtaacc
ttcgtcgccattttaaccgccgcgaatctgaagagcgtcaacctggtcgctaacttcaat
accctgtttgtactggtgcaaatctccatcatggtggtgtttatcttcctggtagttcag
ggactgcataaaggagaaggcgttggcaccgtctggtcacttcagccgtttatcagcgag
aacgcgcacctgatcccgattattaccggggcgacgattgtctgtttctccttcctcggt
ttcgatgcggtgaccacgctttcggaagagacgccggacgccgcacgcgtgatcccgaaa
gccatcttcctgacggcggtctacggtggcgttatctttatcgcggcgtcgttctttatg
cagctgttctttcccgatatcagccgctttaaagatccggatgccgcactgcctgaaatt
gcgctgtacgtcggcggcaagctcttccagtcgattttcctctgcaccacgtttgtgaac
acgttagcctctggcctggcttcacatgccagcgtgtcgcgtctgctgtatgtgatgggg
cgtgacaatgtgtttccggagcgcgtgtttggctatgtgcacccaaaatggcggactccg
gcactcaacgtcattatggtcgggattgtcgcgttgtcggcgctgttcttcgatttagtt
accgccacagcgttaattaacttcggtgctctggtggcgtttaccttcgtgaatctgtcg
gtgtttaatcatttctggcggcgtaaaggaatgaataaaagctggaaggatcacttccac
tatttgctgatgccgctggttggcgcgctgacggtgggtgtgctgtgggttaacctcgag
tcaacgtcactgacactcggtctggtatgggcttcgttaggcggcgcatatttatggtat
ctgatccgccgctatcgcaaagtgccgttgtatgatggtgacagaacgccggtgagtgaa
acgtaa

DBGET integrated database retrieval system