KEGG   Escherichia coli K-12 MG1655: b1329Help
Entry
b1329             CDS       T00007                                 

Gene name
mppA
Definition
(RefSeq) murein tripeptide (L-ala-gamma-D-glutamyl-meso-DAP) transporter subunit
  KO
K15580  oligopeptide transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco01501  beta-Lactam resistance
eco02010  ABC transporters
eco02024  Quorum sensing
Module
eco_M00439  Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b1329 (mppA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    b1329 (mppA)
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    b1329 (mppA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1329 (mppA)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    b1329 (mppA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-GeneID: 945951
NCBI-ProteinID: NP_415845
RegulonDB: ECK120003260
ECOCYC: G6665
ASAP: ABE-0004460
UniProt: P77348
Structure
PDB: 

Position
1393227..1394840
Genome map
AA seq 537 aa AA seqDB search
MKHSVSVTCCALLVSSISLSYAAEVPSGTVLAEKQELVRHIKDEPASLDPAKAVGLPEIQ
VIRDLFEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQ
RLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNL
TANFAFFPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQ
KVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTYYYAFNTQ
KGPTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTAGFTPEPSPFEQMSQEEL
NAQAKTLLSAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQNQEWKTY
IDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQASTENTVK
ARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKGYPINNPEDVAYSRTMYIVKH
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaagcactctgtttcagtcacgtgttgtgcgctgttggtcagcagcatttctctttcg
tatgctgcagaagttccgagcggcacagtactggcagagaagcaggagctggtgcgccac
attaaagatgagcctgcgtcgctggatcccgctaaagccgtgggcctgccagagattcag
gtcattcgcgatctgtttgaaggtctggtgaatcagaacgaaaaaggggagattgtcccc
ggcgttgcgactcagtggaaaagtaatgacaaccgtatctggacttttaccctgcgcgat
aacgcaaaatgggcggatggcacaccggtaacggcgcaagattttgtctacagctggcaa
cgtctggtggacccaaaaacattgtcgccatttgcatggtttgccgcgctggcgggaatc
aacaacgcacaggcgattattgatggtaaagctacgcctgaccagcttggcgtcaccgca
gttgatgcccatactttgaaaattcagcttgataaaccgttgccgtggtttgtgaattta
accgctaactttgccttcttcccggtgcaaaaagccaacgtagaaagcggtaaagagtgg
acgaaacccggaaatctgatcggcaatggcgcttatgttcttaaagagcgcgtagtcaat
gaaaaactggtcgtggtaccgaatacccattattgggataacgccaaaacggtactgcaa
aaagtgaccttcctgccaattaatcaggaatccgcagccactaagcgttacctcgcgggg
gatattgatatcaccgaatccttcccgaaaaatatgtatcagaagctgttgaaggatatt
ccggggcaggtttatacgccgccgcagctcgggacctattattatgcgtttaacacgcaa
aaagggccgacggcagatcagcgcgttcgtctggcattaagtatgacgatagatcgccgc
ctgatgaccgaaaaagtattagggacgggcgaaaagccagcgtggcattttacaccagat
gttaccgcgggatttacgccggaaccttcgccgtttgaacaaatgagtcaggaagaactg
aatgcgcaggcaaaaactttgttgagcgcagctggttatggtccgcaaaaaccgctgaag
ctgacgcttttgtataacacttcagaaaaccatcaaaaaattgcgattgctgtagcatcg
atgtggaaaaagaaccttggcgtagatgttaaattgcaaaatcaggaatggaaaacctat
atcgatagccgtaacaccggcaattttgatgttatccgcgcctcgtgggtgggggattat
aatgaaccctccactttcctgacattattaacgtcaacgcattcaggaaatatttcacgc
tttaacaatccggcatatgacaaagttctggcccaggcatcgacggaaaataccgttaaa
gcgcgtaatgccgattacaacgcggcagaaaaaatcctcatggagcaagcaccgattgca
ccaatttatcaatataccaatggacgattaatcaagccgtggctgaaaggttatcccatt
aataatcctgaagatgtggcgtacagtcggactatgtatattgtgaagcattga

DBGET integrated database retrieval system