KEGG   Escherichia coli K-12 MG1655: b1337
Entry
b1337             CDS       T00007                                 

Gene name
abgB
Definition
(RefSeq) p-aminobenzoyl-glutamate hydrolase subunit B
  KO
K12941  aminobenzoyl-glutamate utilization protein B
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eco01002]
    b1337 (abgB)
Peptidases and inhibitors [BR:eco01002]
 Metallo peptidases
  Family M20
   b1337 (abgB)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer
Other DBs
NCBI-GeneID: 945950
NCBI-ProteinID: NP_415853
Pasteur: abgB
RegulonDB: ECK120003264
ECOCYC: G6669
ASAP: ABE-0004491
UniProt: P76052
Position
complement(1401810..1403255)
AA seq 481 aa
MQEIYRFIDDAIEADRQRYTDIADQIWDHPETRFEEFWSAEHLASALESAGFTVTRNVGN
IPNAFIASFGQGKPVIALLGEYDALAGLSQQAGCAQPTSVTPGENGHGCGHNLLGTAAFA
AAIAVKKWLEQYGQGGTVRFYGCPGEEGGSGKTFMVREGVFDDVDAALTWHPEAFAGMFN
TRTLANIQASWRFKGIAAHAANSPHLGRSALDAVTLMTTGTNFLNEHIIEKARVHYAITN
SGGISPNVVQAQAEVLYLIRAPEMTDVQHIYDRVAKIAEGAALMTETTVECRFDKACSSY
LPNRTLENAMYQALSHFGTPEWNSEELAFAKQIQATLTSNDRQNSLNNIAATGGENGKVF
ALRHRETVLANEVAPYAATDNVLAASTDVGDVSWKLPVAQCFSPCFAVGTPLHTWQLVSQ
GRTSIAHKGMLLAAKTMAATTVNLFLDSGLLQECQQEHQQVTDTQPYHCPIPKNVTPSPL
K
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgcaggaaatctatcgttttatcgacgatgcgattgaagccgatcgccaacgttatacc
gatattgccgatcaaatctgggatcatccagaaacacgttttgaagagttctggtcagcg
gagcatctggcttcggcgctggaatctgcaggcttcaccgttacccgcaacgtaggcaat
atcccaaatgcctttattgcttcgtttggtcaaggcaaaccggttatcgccctgctggga
gaatatgacgccctggcaggtttaagtcagcaagcaggttgcgcgcaacctacatccgtg
acgcccggtgaaaatggtcacggttgcggacacaatttgctgggaaccgccgcctttgcc
gctgcaatagccgtcaagaaatggctggaacaatatgggcaaggcggcacggtgcgcttt
tatggttgtcctggcgaagaaggcggctcgggtaaaacgttcatggttcgcgagggggta
tttgatgatgtggatgcggcactcacctggcacccggaagcctttgccggtatgttcaat
acccgcacgctggcaaacattcaggcatcatggcgctttaaagggatcgcagcacatgcc
gcgaattcccctcatttgggacgcagcgcccttgatgccgtaacgttgatgaccactggc
accaacttcctcaacgaacatattattgaaaaagcgcgcgtacactatgccatcacaaat
agcggcgggatctcgcccaacgtggtccaggcgcaggcagaagtgctttatcttatccgc
gcccccgaaatgaccgacgtgcagcatatttatgatcgggtcgccaaaatcgccgaaggt
gcggcattgatgaccgaaaccacggttgaatgccgcttcgacaaagcctgttccagttat
ctcccgaatcgcaccttagaaaatgccatgtaccaggccctatcccattttggtaccccg
gaatggaactccgaagaactggcttttgcgaaacaaattcaggctacgctcacctccaac
gatcggcaaaacagtctgaataatatcgccgcaaccggtggcgaaaacggcaaggttttt
gcactacgtcatcgtgaaacggtactggcgaatgaagtcgctccatatgccgccaccgat
aacgtgcttgcggcatcgactgatgtcggcgacgtcagttggaaactgcctgttgcccag
tgtttcagcccctgttttgccgtcggtacaccgctacatacgtggcaactggttagccag
gggcgaacatctattgctcataaaggaatgctgctggcggcgaaaactatggcagcaacc
acagtcaatctcttccttgattcagggctattgcaagaatgccaacaagagcatcagcaa
gtaacggacacgcaaccgtatcactgccctatcccgaaaaacgtgacaccgtcaccttta
aaataa

DBGET integrated database retrieval system