KEGG   Escherichia coli K-12 MG1655: b1376
Entry
b1376             CDS       T00007                                 

Gene name
uspF
Definition
(RefSeq) nucleotide binding filament protein
  KO
K14061  universal stress protein F
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    b1376 (uspF)
SSDB
Motif
Pfam: Usp
Other DBs
NCBI-GeneID: 945948
NCBI-ProteinID: NP_415894
Pasteur: ynaF
RegulonDB: ECK120003294
ECOCYC: G6699
ASAP: ABE-0004605
UniProt: P37903
Position
complement(1435185..1435619)
AA seq 144 aa
MNRTILVPIDISDSELTQRVISHVEEEAKIDDAEVHFLTVIPSLPYYASLGLAYSAELPA
MDDLKAEAKSQLEEIIKKFKLPTDRVHVHVEEGSPKDRILELAKKIPAHMIIIASHRPDI
TTYLLGSNAAAVVRHAECSVLVVR
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaacagaacgattcttgtccctatcgatatttccgattcagaattaactcaacgcgtg
attagccacgttgaggaagaggcaaagattgatgatgcagaggttcatttcctgacggta
ataccttcactgccctactatgcctctctgggtttagcgtattccgcagaattaccggca
atggatgacctgaaagcggaagccaaatcgcaactggaagagatcattaaaaaatttaaa
ctgccaaccgacagagtgcatgtccatgttgaggaaggctcgcccaaagaccgcattctg
gaattggcgaagaagatccccgctcatatgatcatcattgcttcccatcgaccggatatc
accacttatctgctcggttccaacgccgcagctgtagtgcgtcacgcagagtgctccgtg
ctggttgtgcgctga

DBGET integrated database retrieval system