KEGG   Escherichia coli K-12 MG1655: b1378
Entry
b1378             CDS       T00007                                 

Gene name
ydbK
Definition
(RefSeq) putative pyruvate-flavodoxin oxidoreductase
  KO
K03737  pyruvate-ferredoxin/flavodoxin oxidoreductase [EC:1.2.7.1 1.2.7.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00010  Glycolysis / Gluconeogenesis
eco00020  Citrate cycle (TCA cycle)
eco00620  Pyruvate metabolism
eco00650  Butanoate metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01200  Carbon metabolism
Module
eco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b1378 (ydbK)
   00020 Citrate cycle (TCA cycle)
    b1378 (ydbK)
   00620 Pyruvate metabolism
    b1378 (ydbK)
   00650 Butanoate metabolism
    b1378 (ydbK)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     b1378 (ydbK)
    1.2.7.-  
     b1378 (ydbK)
SSDB
Motif
Pfam: POR_N POR EKR PFOR_II Fer4_16 Fer4_7 Fer4 TPP_enzyme_C Fer4_9 Fer4_21 Fer4_6 Fer4_10 Fer4_17 Fer4_2 Fer4_18 Fer4_8 Transketolase_C Fer4_13 HEAT_2 FlgM Fer4_4
Other DBs
NCBI-GeneID: 946587
NCBI-ProteinID: NP_415896
Pasteur: ydbK
RegulonDB: ECK120003296
ASAP: ABE-0004613
UniProt: P52647
Position
complement(1437260..1440784)
AA seq 1174 aa
MITIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPRVVEMQSE
AGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAANVQEAQDFALISQIATLKSRVPFIHFFDGFRTSHEINKIV
PLADDTILDLMPQVEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVE
QAMNDFSAATGRQYQPFEYYGHPQAERVIILMGSAIGTCEEVVDELLTRGEKVGVLKVRL
YRPFSAKHLLQALPGSVRSVAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGERETLPRVI
GGRYGLSSKEFGPDCVLAVFAELNAAKPKARFTVGIYDDVTNLSLPLPENTLPNSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEQPIRSAYL
ISQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSADEVWSRLPQEVQAVLNQKKARF
YVINAAKIARECGLAARINTVMQMAFFHLTQILPGDSALAELQGAIAKSYSSKGQDLVER
NWQALALARESVEEVPLQPVNPHSANRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPIWKEELCTQCNHCVAACPHSAIRAKVVPPEAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPEIKAINMMSRLEHVEEE
KINYDFFLNLPEIDRSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLTVDQHRVRVLRL
LDQFADKIPAELLTALKSDATPEVRREQVAALRQQLNDVAEAHELLRDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKLPLALDSRPPSEAPEETLLHEQRFRRLNSQQP
EVAEQLWKDAAADLQKRYDFLAQMAGKAEKSNTD
NT seq 3525 nt   +upstreamnt  +downstreamnt
atgattactattgacggtaatggcgcggttgcttcggtcgcatttcgcaccagtgaagtt
atcgccatctaccctattacccccagttccacgatggcagaacaggctgatgcctgggcc
ggaaacggcttaaagaacgtttggggagacacaccacgcgtggttgaaatgcagtcggaa
gcgggtgctatcgctaccgtgcatggcgctttgcagacgggtgccctttcaacatcgttt
acgtcatcgcagggtttgctgctgatgatcccgacgctgtacaaactggcaggcgaacta
acaccgtttgtcctgcatgtagcggcacgtaccgttgccacacatgcactctctattttt
ggcgatcattccgacgttatggcggtgcgccagacgggttgcgcgatgttgtgtgcagca
aacgtccaggaagcgcaagactttgctctcatttcgcaaatcgcgacgctgaaaagccgc
gtgccatttattcatttctttgatggtttccgcacgtcccacgaaatcaataaaattgtc
ccgctggccgatgacacgattcttgatctcatgccgcaggtcgaaattgatgctcatcgc
gcccgggcactcaacccggaacatccggtgatccgcggtacgtccgccaatcctgacact
tatttccagtctcgcgaagccaccaacccatggtacaacgcggtctatgaccatgttgaa
caggcgatgaatgatttctctgccgcgacaggtcgtcagtatcagccgtttgaatattac
gggcatccgcaagcggaacgggtgattatcctgatgggctctgccattggcacctgtgaa
gaagtggttgatgaattgctaacccgtggcgaaaaagttggcgtgctgaaagttcgcctg
taccgccccttctccgctaaacatttactgcaagctctgccgggatccgtacgcagcgtg
gcggtactggacagaaccaaagaacccggtgcccaggcagaaccgctctatctggatgta
atgaccgcactggcagaagcctttaataatggcgagcgcgaaactctgccccgtgtcatt
ggtgggcgctatggtctttcatccaaagaatttggcccagactgtgtactggcggtattt
gccgagctcaacgcggctaaaccgaaagcgcgctttacggttggtatttacgatgatgtg
accaatctgtcactgccgttgccggaaaacaccctgccaaactcggcgaaactggaagcc
ttgttttatggccttggtagtgatggcagcgtttccgcgaccaaaaacaatatcaagatt
atcggtaattccacgccgtggtacgcacagggctattttgtttacgactccaaaaaggcg
ggcggcctgacggtttctcaccttcgagtgagcgaacagccgattcgttccgcttatctc
atttcccaggctgattttgttggctgccaccagttgcagtttatcgataaatatcagatg
gctgagcgtttaaaacctggcggcattttcctgctcaacacgccgtacagcgcagatgaa
gtgtggtcgcgcttgccgcaagaagttcaggccgtgttaaaccagaaaaaagcgcgcttc
tatgtgattaacgcggcgaaaatcgcccgcgaatgtggcctggcggcccgtattaatacc
gtcatgcagatggcttttttccatctgacgcaaattctgcctggcgatagcgccctcgca
gaattgcagggtgcgattgccaaaagttacagtagcaaaggccaggatctggtggaacgc
aactggcaggctctggcgctggcgcgtgaatccgtagaagaagttccgttgcaaccggta
aatccgcacagcgccaatcgaccgccagtggtttccgatgccgcccctgatttcgtgaaa
accgtaaccgctgcgatgctcgccgggcttggtgacgccctccccgtttcggcgctgccg
ccagacggcacctggccgatgggcactacgcgctgggaaaaacgcaatatcgccgaagag
atccccatctggaaagaggaactctgtacccaatgtaaccactgcgttgccgcttgccca
cactcagctattcgcgcaaaagtggtgccgcctgaagcgatggaaaacgcccctgccagc
ctgcattcgctggatgtgaaatcgcgtgatatgcgcgggcagaaatatgtcttgcaggtg
gcaccggaagattgcaccggttgtaacctgtgcgtcgaagtttgcccggcgaaagaccgt
cagaatccagagattaaagccatcaatatgatgtctcgcctggaacatgtcgaagaagag
aaaatcaattacgatttcttcctcaacctgccagaaatcgaccgtagcaaactggaacgt
attgatattcgtacatcgcagctgattacaccgctgtttgaatattcaggtgcttgctcc
ggttgtggcgagacgccgtatattaaattactgactcagctctatggcgaccggatgttg
atcgctaacgccactggctgttcttcaatttatggcggtaacctgccctctacaccgtat
accaccgatgccaacggtcgtgggccggcatgggcgaactctctatttgaagataatgcc
gaatttggccttggtttccgcctgacggtcgatcaacaccgtgtccgcgtgctgcgtctg
ctggatcaatttgccgataaaatcccggcggaattactgacggcgttgaaatcagacgcc
acgccagaggttcgtcgtgaacaggttgcagctttacgccagcaactcaacgatgttgcc
gaagcacatgaactgctacgtgatgcagatgcactggtggaaaaatcaatctggctgatt
ggtggtgatggctgggcttacgatatcggctttggcggtctggatcatgtattgagtttg
acggaaaacgtcaacattctggtgctggatacgcaatgctattccaacaccggtggtcag
gcgtcgaaagcgacaccgctgggtgcagtaactaaatttggcgagcacggcaaacgtaaa
gcgcgtaaagatcttggcgtcagtatgatgatgtacggtcatgtttatgtggcgcagatt
tctctcggcgcgcagctgaaccagacggtgaaagcgattcaggaagcggaagcgtatccg
gggccatcgctgatcattgcttatagcccgtgtgaagagcatggttacgatctggcactc
agccacgaccagatgcgccaactcacagctaccggcttctggccgctatatcgctttgat
ccgcgtcgtgccgatgaaggcaaactgccgctggccttggattcacgcccgccgtcagaa
gcaccggaagaaacgttacttcacgagcaacgtttccgtcggctgaattcgcagcagcca
gaagtggcagaacagttatggaaagatgctgcagctgatttgcaaaaacgctatgacttc
ctggcacaaatggccggaaaagcggaaaaaagcaacaccgattaa

DBGET integrated database retrieval system