KEGG   Escherichia coli K-12 MG1655: b1385Help
Entry
b1385             CDS       T00007                                 

Gene name
feaB
Definition
(RefSeq) phenylacetaldehyde dehydrogenase
  KO
K00146  phenylacetaldehyde dehydrogenase [EC:1.2.1.39]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00360  Phenylalanine metabolism
eco01100  Metabolic pathways
eco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    b1385 (feaB)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    b1385 (feaB)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.39  phenylacetaldehyde dehydrogenase
     b1385 (feaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 945933
NCBI-ProteinID: NP_415903
Pasteur: feaB
RegulonDB: ECK120004448
ECOCYC: G7961
ASAP: ABE-0004637
UniProt: P80668
Position
1447519..1449018
Genome map
AA seq 499 aa AA seqDB search
MTEPHVAVLSQVQQFLDRQHGLYIDGRPGPAQSEKRLAIFDPATGQEIASTADANEADVD
NAVMSAWRAFVSRRWAGRLPAERERILLRFADLVEQHSEELAQLETLEQGKSIAISRAFE
VGCTLNWMRYTAGLTTKIAGKTLDLSIPLPQGARYQAWTRKEPVGVVAGIVPWNFPLMIG
MWKVMPALAAGCSIVIKPSETTPLTMLRVAELASEAGIPDGVFNVVTGSGAVCGAALTSH
PHVAKISFTGSTATGKGIARTAADHLTRVTLELGGKNPAIVLKDADPQWVIEGLMTGSFL
NQGQVCAASSRIYIEAPLFDTLVSGFEQAVKSLQVGPGMSPVAQINPLVSRAHCDKVCSF
LDDAQAQQAELIRGSNGPAGEGYYVAPTLVVNPDAKLRLTREEVFGPVVNLVRVADGEEA
LQLANDTEYGLTASVWTQNLSQALEYSDRLQAGTVWVNSHTLIDANLPFGGMKQSGTGRD
FGPDWLDGWCETKSVCVRY
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacagagccgcatgtagcagtattaagccaggtccaacagtttctcgatcgtcaacac
ggtctttatattgatggtcgtcctggccccgcacaaagtgaaaaacggttggcgatcttt
gatccggccaccgggcaagaaattgcgtctactgctgatgccaacgaagcggatgtagat
aacgcagtcatgtctgcctggcgggcctttgtctcgcgtcgctgggccgggcgattaccc
gcagagcgtgaacgtattctgctacgttttgctgatctggtggagcagcacagtgaggag
ctggcgcaactggaaaccctggagcaaggcaagtcaattgccatttcccgtgcttttgaa
gtgggctgtacgctgaactggatgcgttataccgccgggttaacgaccaaaatcgcgggt
aaaacgctggacttgtcgattcccttaccccagggggcgcgttatcaggcctggacgcgt
aaagagccggttggcgtagtggcgggaattgtgccatggaactttccgttgatgattggt
atgtggaaggtgatgccagcactggcagcaggctgttcaatcgtgattaagccttcggaa
accacgccactgacgatgttgcgcgtggcggaactggccagcgaggctggtatccctgat
ggcgtttttaatgtcgtcaccgggtcaggtgctgtatgcggcgcggccctgacgtcacat
cctcatgttgcgaaaatcagttttaccggttcaaccgcgacgggaaaaggtattgccaga
actgctgctgatcacttaacgcgtgtaacgctggaactgggcggtaaaaacccggcaatt
gtattaaaagatgctgatccgcaatgggttattgaaggcttgatgaccggaagcttcctg
aatcaagggcaagtatgcgccgccagttcgcgaatttatattgaagcgccgttgtttgac
acgctggttagtggatttgagcaggcggtaaaatcgttgcaagtgggaccggggatgtca
cctgttgcacagattaaccctttggtttctcgtgcgcactgcgacaaagtgtgttcattc
ctcgacgatgcgcaggcacagcaagcagagctgattcgcgggtcgaatggaccagccgga
gaggggtattatgttgcgccaacgctggtggtaaatcccgatgctaaattgcgcttaact
cgtgaagaggtgtttggtccggtggtaaacctggtgcgagtagcggatggagaagaggcg
ttacaactggcaaacgacacggaatatggcttaactgccagtgtctggacgcaaaatctc
tcccaggctctggaatatagcgatcgcttacaggcagggacggtgtgggtaaacagccat
accttaattgacgctaacttaccgtttggtgggatgaagcagtcaggaacgggccgtgat
tttggccccgactggctggacggttggtgtgaaactaagtcggtgtgtgtacggtattaa

DBGET integrated database retrieval system