KEGG   Escherichia coli K-12 MG1655: b1466Help
Entry
b1466             CDS       T00007                                 

Gene name
narW
Definition
(RefSeq) nitrate reductase 2 (NRZ), delta subunit (assembly subunit)
  KO
K00373  nitrate reductase molybdenum cofactor assembly chaperone NarJ/NarW
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    b1466 (narW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitrate_red_del
Motif
Other DBs
NCBI-GeneID: 946032
NCBI-ProteinID: NP_415983
Pasteur: narW
RegulonDB: ECK120000638
ECOCYC: EG10645
ASAP: ABE-0004892
UniProt: P19317
Position
complement(1536614..1537309)
Genome map
AA seq 231 aa AA seqDB search
MQILKVIGLLMEYPDELLWECKEDALALIRRDAPMLTDFTHNLLNAPLLDKQAEWCEVFD
RGRTTSLLLFEHVHAESRDRGQAMVDLLAEYEKVGLQLDCRELPDYLPLYLEYLSVLPDD
QAKEGLLNVAPILALLGGRLKQREAPWYALFDALLQLAGSSLSSDSVTKQVNSEERDDTR
QALDAVWEEEQVKFIEDNATACDSSPLNQYQRRFSQDVAPQYVDISAGGGK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcctcaaagtgatcggcctgttgatggagtatccggacgagctgttgtgggaa
tgcaaggaggacgcgctggcgttgatccgccgcgacgcgccgatgcttacggatttcacc
cacaacctgcttaacgcgccgctgctggataaacaggccgaatggtgcgaagtgtttgac
cgcgggcgcaccacgtcgctgctgctgttcgaacatgttcatgccgagtcccgcgatcgc
ggccaggcaatggtggacctgctggcggagtatgaaaaggtcggcctgcagctggattgt
cgggaactgcccgattatctaccgctgtatctggagtatttaagcgtactgcctgacgat
caggcgaaagaaggattgctcaatgttgcgccgatcctcgccctgcttggcggtcgctta
aaacaacgcgaggcaccgtggtacgcgttgtttgatgctctgctgcaactggcgggaagc
tccctttcaagtgacagtgtcacaaaacaagtaaacagcgaagagcgcgatgacacccgc
caggcgcttgatgcagtgtgggaagaggaacaggtgaagtttattgaagataacgccacg
gcgtgtgacagctcgccgcttaatcaatatcagcgacgctttagccaggatgtcgcgccg
caatatgtcgacatcagtgcgggaggtgggaaatga

DBGET integrated database retrieval system