KEGG   Escherichia coli K-12 MG1655: b1473
Entry
b1473             CDS       T00007                                 
Symbol
yddG
Name
(RefSeq) amino acid exporter YddG
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-GeneID: 945942
NCBI-ProteinID: NP_415990
RegulonDB: ECK120002370
ECOCYC: EG12713
ASAP: ABE-0004912
UniProt: P46136
Position
complement(1546288..1547169)
AA seq 293 aa
MTRQKATLIGLIAIVLWSTMVGLIRGVSEGLGPVGGAAAIYSLSGLLLIFTVGFPRIRQI
PKGYLLAGSLLFVSYEICLALSLGYAATHHQAIEVGMVNYLWPSLTILFAILFNGQKTNW
LIVPGLLLALVGVCWVLGGDNGLHYDEIINNITTSPLSYFLAFIGAFIWAAYCTVTNKYA
RGFNGITVFVLLTGASLWVYYFLTPQPEMIFSTPVMIKLISAAFTLGFAYAAWNVGILHG
NVTIMAVGSYFTPVLSSALAAVLLSAPLSFSFWQGALMVCGGSLLCWLATRRG
NT seq 882 nt   +upstreamnt  +downstreamnt
atgacacgacaaaaagcaacgctcatagggctgatagcgatcgtcctgtggagcacgatg
gtaggattgattcgcggtgtcagtgaggggctcggcccggtcggcggcgcagctgctatc
tattcattaagcgggctgctgttaatcttcacggttggatttccgcgtattcggcaaatc
ccgaaaggctatttactcgccgggagtctgttattcgtcagctatgaaatctgtctggcg
ctttccttagggtatgcggcgacccatcatcaggcgattgaagtgggtatggtgaactat
ctgtggcccagcctgacaattctctttgccattctgtttaatggtcagaaaaccaactgg
ttgattgtacctggattattattagccctcgtcggcgtctgttgggtgttaggcggtgac
aatgggttacattatgatgaaatcatcaataatatcaccaccagcccattgagttatttc
ctggcgttcattggtgcgtttatctgggcagcctattgcacagtaacgaataaatacgca
cgcggatttaatggaattaccgtttttgtcctgctaacgggagcaagtctgtgggtttac
tattttcttacgccacaaccagaaatgatatttagcacgcccgtcatgattaaactcatc
tctgcggcatttaccttaggatttgcttatgctgcatggaatgtcggtatattgcatggc
aatgtcaccattatggcggtaggttcgtattttacgcctgtactttcctcagcgcttgca
gccgtgctgctcagcgccccgctgtcgttctcgttctggcaaggcgcgctgatggtctgc
ggcggttccctgctctgctggctggcgacacgtcgtggttaa

DBGET integrated database retrieval system