KEGG   Escherichia coli K-12 MG1655: b1484Help
Entry
b1484             CDS       T00007                                 

Gene name
ddpD
Definition
(RefSeq) D,D-dipeptide ABC transporter ATPase
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02024  Quorum sensing
Module
eco_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    b1484 (ddpD)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    b1484 (ddpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 AAA_16 AAA_29 AAA_33 GvpO AAA_5 AAA_22
Motif
Other DBs
NCBI-GeneID: 946002
NCBI-ProteinID: NP_416001
Pasteur: yddP
RegulonDB: ECK120003367
ECOCYC: G6778
ASAP: ABE-0004949
UniProt: P77268
Position
complement(1558031..1559017)
Genome map
AA seq 328 aa AA seqDB search
MTQPVLDIQQLHLSFPGFNGDVHALNNVSLQINRGEIVGLVGESGSGKSVTAMLIMRLLP
TGSYCVHRGQISLLGEDVLNAREKQLRQWRGARVAMIFQEPMTALNPTRRIGLQMMDVIR
HHQPISRREARAKAIDLLEEMQIPDAVEVMSRYPFELSGGMRQRVMIALAFSCEPQLIIA
DEPTTALDVTVQLQVLRLLKHKARASGTAVLFISHDMAVVSQLCDSVYVMYAGSVIESGV
TADVIHHPRHPYTIGLLQCAPEHGVPRQLLPAIPGTVPNLTHLPDGCAFRDRCYAAGAQC
ENVPALTACGDNNQRCACWYPQQEVISV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacccgttctggacattcaacaactgcatttgagtttccccggttttaacggt
gatgttcacgcgctcaacaatgtgtccttgcagattaaccgcggtgaaattgtcggtctg
gtgggagaatccggctcaggtaaatcagtcaccgcaatgctgattatgcgtctgctaccg
acgggcagttattgcgtacatcgggggcagatttccctgctgggagaagatgttcttaac
gcgcgggaaaaacagcttcgtcagtggcgcggcgcacgagtggcgatgatctttcaggaa
ccgatgaccgccctcaatccgacacgtcgaataggtcttcagatgatggacgtgatccgc
catcatcaaccaataagtcgtcgggaagccagagctaaagcgattgacctgctggaagag
atgcaaatcccggatgccgtggaagttatgtcgcgctatccgtttgagctttcaggtggt
atgcgccagcgggtaatgattgcgctggcattctcctgcgagccgcaattgattattgcc
gacgaaccgactacggcgctggacgtcacggtgcagttgcaggtactgcgtttgcttaaa
cataaagcccgcgccagtggaactgcggttctgttcatcagccatgatatggccgtggtg
tcgcaactgtgcgatagcgtttacgtgatgtatgccggaagcgtaattgaaagcggcgtg
acggcagacgttatccatcatccccggcatccgtataccattggtttgctgcaatgcgca
ccagaacatggagtaccacgccagctattacccgccattccagggacggtaccaaacctc
acccatttgcctgacggctgcgcttttcgcgatcgttgctatgcggcaggtgcacagtgt
gaaaacgtcccggcgctgacagcgtgtggtgacaacaaccagcgctgtgcctgttggtat
ccgcagcaggaggttataagtgtctga

DBGET integrated database retrieval system