KEGG   Escherichia coli K-12 MG1655: b1486Help
Entry
b1486             CDS       T00007                                 

Gene name
ddpB
Definition
(RefSeq) D,D-dipeptide ABC transporter permease
  KO
K02033  peptide/nickel transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02024  Quorum sensing
Module
eco_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    b1486 (ddpB)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    b1486 (ddpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 946044
NCBI-ProteinID: NP_416003
Pasteur: yddR
RegulonDB: ECK120003369
ECOCYC: G6780
ASAP: ABE-0004955
UniProt: P77308
Position
complement(1559907..1560929)
Genome map
AA seq 340 aa AA seqDB search
MTFWSILRQRCWGLVLVVAGVCVITFIISHLIPGDPARLLAGDRASDAIVENIRQQLGLD
QPLYVQFYRYVSDLFHGDLGTSIRTGRPVLEELRIFFPATLELAFGALLLALLIGIPLGI
LSAVWRNRWLDHLVRIMAITGISTPAFWLGLGVIVLFYGHLQILPGGGRLDDWLDPPTHV
TGFYLLDALLEGNGEVFFNALQHLILPALTLAFVHLGIVARQIRSAMLEQLSEDYIRTAR
ASGLPGWYIVLCYALPNALIPSITVLGLALGDLLYGAVLTETVFAWPGMGAWVVTSIQAL
DFPAVMGFAVVVSFAYVLVNLVVDLLYLWIDPRIGRGGGE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttctggagtattttacgccaacgctgctgggggctggtgctcgtggtggcgggc
gtctgcgtgattacgtttattatctcgcatctgatccctggtgatccggcgcggttactg
gcgggtgaccgcgccagcgatgctatcgtggaaaatattcgccagcaactgggactggac
cagccactgtatgtacagttttaccgctacgtcagcgacctgtttcatggtgacctggga
acatccattcgtaccgggcgtccggtgctggaagagttgcgtatatttttcccggcgacg
ctggagctggcttttggtgccctgctgctggcactcctgattggcatcccgctgggcata
ctctctgcagtctggcgaaatcgctggctggatcatctggtgcgaataatggccattacc
ggaatctccacacctgcgttctggcttgggctgggcgtcattgtgctgttttatggtcat
ctgcaaattcttcccggcggcggaaggcttgatgactggctggatccaccaacgcacgtt
accggcttttatctgctcgatgcgctgcttgaaggcaacggtgaagtcttcttcaatgcg
ttgcaacatctcatcttaccggcattaacgctggcgttcgttcacctgggaattgtcgct
cgccagatccgctcagcgatgctggaacaattgagtgaagactacattcgtaccgcccgg
gccagcggcttgcccggctggtatatcgttttatgttatgcgctacccaatgcgttgatc
ccatcgattaccgtattgggtttggcgctgggcgatttgttgtatggcgcagtgctcacc
gaaaccgtttttgcctggcccggaatgggtgcatgggtagtaacatcaatacaggcgctc
gacttcccggcagtgatgggctttgccgtcgtggtttcatttgcttatgtgctggtcaac
ctggtggtggatttgctctatttgtggattgatccgcgtatcggacgtggaggtggtgaa
tga

DBGET integrated database retrieval system